Conserved Protein Domain Family
BBC

?
smart00502: BBC 
B-Box C-terminal domain
Coiled coil region C-terminal to (some) B-Box domains
Statistics
?
PSSM-Id: 128778
View PSSM: smart00502
Aligned: 20 rows
Threshold Bit Score: 103.113
Threshold Setting Gi: 66774189
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q09654        208 LREKVREHLGELSKQSETIGNALHSIDSVIHELTpgqedGSLEETRQEVRNHFRRLRTALDRDEEDAVETVDRYARNRVE 287  Caenorhabditi...
Q91885        196 KKEKLGKVLEKLTLEREEAEREVQGLQEDLK--------EKAAGETERVTVLFRDIRKWVDSLEKQMLDVLSRQKEKLSR 267  African clawe...
AAB05872      183 KKEKLREVLEKLRPERVETVKAAQKLEERRREVA-----EKAAGETERVTALFRDIREQLETLENRLLGDLSSQKEKITL 257  African clawe...
BAA13398      159 HKSQLSQALNGLSDRAKEAKEFLVQLRNMVQQIQ-----ENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLK 233  human
Q19818        280 IREDVTSTVDRVEKKYNNSVADMNSLPDKSQQLN-----EQYEIAKYRVDKHYEELRNSIEEAYQKSVNDLEEARIRQES 354  Caenorhabditi...
NP_503395     320 HKTELSTTLQQLSEKAKTATEEIGRLKGLHDVVK-----NNCNDFKSSLCIQIDQLIEQLQMRKEKLMQHVDEQADNKRR 394  nematode
NP_001020998  519 IRVAVGEVVNESQLLQWQCEKTGDTIKQIIDGIV-----TNATTAENEIRAAFDTHVNALEERRKELLKRVETVKNLKLS 593  nematode
XP_003262221  246 LKQTLEMNLTNLVKRNSELENQMAKLIQICQQVE-----VNTAMHEAKLMEECDELVEIIQQRKQMIAVKIKETKVMKLR 320  White-cheeked...
NP_498684     268 QMLKMEQLIADARSKHADMLDMFKQVDNKQQVLT-----ASLHNAHAQLEETVSNLINVIQDQKKTLAKDIDNAFAAKQI 342  nematode
Q02084        285 QLIALVSPLETTMKENQKLKCDQSQKISLHRE--------NIVDCKKHIECEFEKLHQFLREKEAKMVEDLNAEREGLLK 356  Iberian ribbe...
Q09654        288 SLQTQKERLEAISSKIGNTCTTLQKALIMERGKILDRKDDLLALAESTAAEP 339  Caenorhabditis elegans
Q91885        268 DLCDVIQNLEIKQDELSGKIRHIEELCNMADPLVVLQERESHGAAFCGAEAA 319  African clawed frog
AAB05872      258 TLTDLMEQLEIKKNILSRKIRHIEELCNMADPFTIPHEWELDEVSERDDIKV 309  African clawed frog
BAA13398      234 VVRDQISHCTVKLRQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQ 285  human
Q19818        355 NIDEMYRKSQVNEARVHDAINFTRRLLTKGNGLELVVSRKKVIQQFGNLSHA 406  Caenorhabditis elegans
NP_503395     395 ILKSQIVKCTGKLTKTSALIQFCIEALKEPDPTVYMQISNALLHRSTSLEFl 446  nematode
NP_001020998  594 VLISQAESLQSKQIDLQQAIQTATKLMDSSDCDEMVLRQVFEKLASCQMGNE 645  nematode
XP_003262221  321 KLAQQVANCRQCLERSTVLINQAEHILKENDQARFLQSAKNIAERVAMATAs 372  White-cheeked Gibbon
NP_498684     343 QLTMVDKRIQSMADKLSQTIEFSRRLMSFASPAEVMVFKQLLDTRLQLFLGF 394  nematode
Q02084        357 DMEANLVKMTDNCEFIEEAISTTQSRLNESDPIAFLTDIKSFIEKCCEEHRK 408  Iberian ribbed newt
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap