Conserved Protein Domain Family
DNaseIc

?
smart00476: DNaseIc 
deoxyribonuclease I
Deoxyribonuclease I catalyzes the endonucleolytic cleavage of double-stranded DNA. The enzyme is secreted outside the cell and also involved in apoptosis in the nucleus.
Statistics
?
PSSM-Id: 128752
View PSSM: smart00476
Aligned: 9 rows
Threshold Bit Score: 447.274
Threshold Setting Gi: 886278
Created: 13-Jul-2011
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9YI04      1 MWRLLLLCALFVPHSLGLRICSFNVQSFGESKRDKPAVMNVVRKIISRCDITLLMEIKDSSNTVIRLLMAQLNS-QSEtr 79  African clawed frog
Q9YGI5      4 LVLELLAAALLLRVAATLRISAFNIRTFGDSKMSNQTVAGFIVSILVQYDITLVQEVRDADLSSVKKLVSQLNS-ASS-- 80  chicken
O42446     10 LVCSLGLFLTLLHLSNSLLLGAFNIKSFGDTKASNATLMNIITKIVKRYDVILIQEVRDSDLSATQTLMNYVNK-DSP-- 86  Mozambique tilapia
O89107      9 YLASLLLFILALHGALSLRLCSFNVRSFGESKKENHNAMDIIVKIIKRCDLILLMEIKDSNNNICPMLMEKLNG-NSRrs 87  Norway rat
NP_037229   6 lmgilltlvnllqlAATLRIAAFNIRTFGDTKMSNATLSSYIVKILSRYDIAVVQEVRDTHLVAVGKLLDELNR-DIP-- 82  Norway rat
BAA11841    6 llgallalaallqgaVSLKIAAFNIQTFGETKMSNATLVSYIVQILSRYDIALVQEVRDSHLTAVGKLLDNLNQ-DAP-- 82  human
NP_776959   6 lmglllalagllqlglslKIAAFNIRTFGETKMSNATLASYIVRIVRRYDIVLIQEVRDSHLVAVGKLLDYLNQ-DDP-- 82  cattle
NP_001365   5 rallaalwaleaaGTAALRIGAFNIQSFGDSKVSDPACGSIIAKILAGYDLALVQEVRDPDLSAVSALMEQINS-VSE-- 81  human
AAB00496    2 HYPTALLFLILANGAQAFRICAFNAQRLTLAKVAREQVMDTLVRILARCDIMVLQEVVDSSGSAIPLLLREINRfDDS-- 79  human
Q9YI04     80 NQFDLTISQRLGRKSYKEQYGFIYRKNLVSVKGTYQYKDLQP-GDEDAFSREPYVVWFQAPST----------------- 141 African clawed frog
Q9YGI5     81 YPYSFLSSIPLGRNSYKEQYVFIYRSDIVSVLESYYYDDGCEsCGTDIFSREPFIVKFSSPTT----------------- 143 chicken
O42446     87 -QYKYIVSEPLGASTYKERYLFLYREALVSVVKSYTYDDGPEeTGQDTFSREPFVVMFSSKNT----------------- 148 Mozambique tilapia
O89107     88 TTYNYVISSRLGRNTYKEQYAFLYKEKLVSVKAKYLYHDYQD-GDTDVFSREPFVVWFQAPFT----------------- 149 Norway rat
NP_037229  83 DNYRYIISEPLGRKSYKEQYLFVYRPSQVSVLDSYHYDDGCEpCGNDTFSREPAIVKFFSPYT----------------- 145 Norway rat
BAA11841   83 DTYHYVVSEPLGRNSYKERYLFVYRPDQVSAVDSYYYDDGCEpCGNDTFNREPAIVRFFSRFT----------------- 145 human
NP_776959  83 NTYHYVVSEPLGRNSYKERYLFLFRPNKVSVLDTYQYDDGCEsCGNDSFSREPAVVKFSSHST----------------- 145 cattle
NP_001365  82 HEYSFVSSQPLGRDQYKEMYLFVYRKDAVSVVDTYLYPD-----PEDVFSREPFVVKFSAPGTgerapplpsrraltppp 156 human
AAB00496   80 GPYSTLSSPQLGRSTYMETYVYFYRSHKTQVLSSYVYND-----EDDVFAREPFVAQFSLPSN----------------- 137 human
Q9YI04    142 ---EVKEFVIVPQHTTPEAAVREIDELYDVYLDVKQKWNSENFIFMGDLNAGCSYVPKKSWKNIRLRNHTEFVWLIGDNN 218 African clawed frog
Q9YGI5    144 ---QLDEFVIVPLHAEPSSAPAEINALTDVYTDVINKWETNNIFFMGDFNADCSYVTAEQWPSIRLRSLSSCEWLIPDSA 220 chicken
O42446    149 ---AVRDFTLIPQHTSPDLAVRELNALYDVVLDVRARWNTNDIVLLGDFNAGCSYVSGSAWQQIRIFTDKTFHWLITDAA 225 Mozambique tilapia
O89107    150 ---AAKDFVIVPLHTTPETSVKEIDELADVYTDVRRRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPNFVWLIGDQE 226 Norway rat
NP_037229 146 ---EVREFAIVPLHSAPTEAVSEIDALYDVYLDVRQKWGLEDIMFMGDFNAGCSYVTSSQWSSIRLRTSPIFQWLIPDSA 222 Norway rat
BAA11841  146 ---EVREFAIVPLHAAPGDAVAEIDALYDVYLDVQEKWGLEDVMLMGDFNAGCSYVRPSQWSSIRLWTSPTFQWLIPDSA 222 human
NP_776959 146 ---KVKEFAIVALHSAPSDAVAEINSLYDVYLDVQQKWHLNDVMLMGDFNADCSYVTSSQWSSIRLRTSSTFQWLIPDSA 222 cattle
NP_001365 157 lpaAAQNLVLIPLHAAPHQAVAEIDALYDVYLDVIDKWGTDDMLFLGDFNADCSYVRAQDWAAIRLRSSEVFKWLIPDSA 236 human
AAB00496  138 ---VLPSLVLVPLHTTPKAVEKELNALYDVFLEVSQHWQSKDVILLGDFNADCASLTKKRLDKLELRTEPSFHWVIADGE 214 human
Q9YI04    219 DTTVKsSTNCAYDRIVVVGEKLVSSIVPGSANVFDFMVAYGLTEEQALEVSDHFPIEVRLK 279 African clawed frog
Q9YGI5    221 DTTVT-STDCAYDRIVACGSALRQAVEYGSATVNNFQETLRIQNKDALAISDHFPVEVTLK 280 chicken
O42446    226 DTTVS-QTVCPYDRIVVT-TDMMRGVVQNSAKVYNYMTDLNLKQDLALAVSDHFPVEVKLS 284 Mozambique tilapia
O89107    227 DTTVKkSTSCAYDRIVLRGQEIVNSVVPRSSGVFDFQKAYELSEEEALDVSDHFPVEFKLQ 287 Norway rat
NP_037229 223 DTTAT-STHCAYDRIVVAGALLQAAVVPSSAVPFDFQAEYRLTNQMAEAISDHYPVEVTLR 282 Norway rat
BAA11841  223 DTTAT-PTHCAYDRIVVAGMLLQGAVVPDSALPFNFQAAYGLSDQLAQAISDHYPVEVMLK 282 human
NP_776959 223 DTTAT-STNCAYDRIVVAGSLLQSSVVPGSAAPFDFQAAYGLSNEMALAISDHYPVEVTLT 282 cattle
NP_001365 237 DTTVG-NSDCAYDRIVACGARLRRSLKPQSATVHDFQEEFGLDQTQALAISDHFPVEVTLK 296 human
AAB00496  215 DTTVRaSTHCTYDRVVLHGERCRSLLH--TAAAFDFPTSFQLTEEEALNISDHYPVEVELK 273 human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap