2D3J


Conserved Protein Domain Family
WIF

?
smart00469: WIF 
Click on image for an interactive view with Cn3D
Wnt-inhibitory factor-1 like domain
Occurs as extracellular domain in metazoan Ryk receptor tyrosine kinases. C. elegans Ryk is required for cell-cuticle recognition. WIF-1 binds to Wnt and inhibits its activity.
Statistics
?
PSSM-Id: 128745
View PSSM: smart00469
Aligned: 6 rows
Threshold Bit Score: 205.021
Threshold Setting Gi: 4585372
Created: 13-Jul-2011
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2D3J_A    11 SLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFrkaqqrMPAIPVNIHSMNFTWQAAGqaeYFYEFLSLRSLDKGIM 90  human
I58386    47 SVSLYLSEDEVRRLLGLDAELYYVRNDLISHYALSF------NLLVPSETNFLHFTWHAKS---KVEYKLGFQVDNFVAM 117 Mus sp.
S58885    21 HLNIFLNLHEVLRLIGVSAELYYVREGAINDYALNF------AVPVPANISDVTFTWQSLVd-hPLPYSINIATSDTEVL 93  fruit fly
AAD24877  19 NVNMFISKEEMNRTFGVKAELNYIEMGNVSSYSTKF------HYRVMANIDYLSFTWNAVGi---VHYEVYVESDDSSVL 89  Caenorhabditis elegans
AAD25403  35 SLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFrkaqqrMPAIPVNIHSMNFTWQAAGqaeYFYEFLSLRSLDKGIM 114 house mouse
AAD31179  27 HLNVFLNPVEVMRLLGVSAEVYYVREGHINNYALNF------IVPVPANVKDISFTWQSLAg-rGLPYSINVVSSDQEVL 99  fruit fly
2D3J_A    91 ADPTVNVPLLGTVPHKASVVQVGFPCLGKQDgvAAFEVDVIVMNSEG-NTILQTPQNAIFFKTCLQ 155 human
I58386   118 GMPQVNISAQGEVPRTLSVFRVELSCTGKVD--SEVMILMQLNLTVN-SSKNFTVLNFKRRKMCYK 180 Mus sp.
S58885    94 PRPILNISRIGDVPVEPQTWGIALKCSGTRN--AEVTVTINVEVILDrATNNNTNLIFKRKKICLR 157 fruit fly
AAD24877  90 --PIVRIPLKGTVPESLQDFTVEYRCAGHRS--GQFAVSLYFTFKYG--NKEPLKVKLRQEKICAS 149 Caenorhabditis elegans
AAD25403 115 ADPTVNVPLLGTVPHKASVVQVGFPCLGKQDgvAAFEVNVIVMNSEG-NTILRTPQNAIFFKTCQQ 179 house mouse
AAD31179 100 PRPAINVSHSGEIPTTIQTWSIALKCSGLKA--AEVDVTVSLEVVLNrSLNNVTHLVFRRKKICLM 163 fruit fly
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap