
Conserved Protein Domain Family

smart00440: ZnF_C2C2 
Click on image for an interactive view with Cn3D
C2C2 Zinc finger
Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
PSSM-Id: 128717
Aligned: 20 rows
Threshold Bit Score: 60.4207
Threshold Setting Gi: 19114147
Created: 12-Jul-2011
Updated: 2-Oct-2020
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
3H0G_I        73 KECPRCHQHEAVFYQTHSRRGDTMMTLIYVCVHCGFAFEE 112 Schizosaccharomyces pombe 972h-
Q65252       204 YKCPNCKQRMCTYREVQTRALDEPSTIFCTCKKCGHEFIG 243 African swine fever virus
Q98202       155 APCPVCRGLNTTPMILQTRASDEEPTVRYVCKDCNKHFSP 194 Molluscum contagiosum virus subtype 1
S47663       141 LQCGKCKSRKTSYYEMQTRSADEPMTVFAKCHSCGSRWKQ 180 Paramecium bursaria Chlorella virus CVK2
NP_012597     84 eKCPQCGNEEMNYHTLQLRSADEGATVFYTCTSCGYKFRt 123 Saccharomyces cerevisiae S288c
EGA78850      61 RECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTS 100 Saccharomyces cerevisiae Vin13
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap