Conserved Protein Domain Family
SCAN

?
smart00431: SCAN 
leucine rich region
Statistics
?
PSSM-Id: 128708
View PSSM: smart00431
Aligned: 20 rows
Threshold Bit Score: 175.571
Threshold Setting Gi: 74722393
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O43309         42 REVFRQYFRQFCYQETSGPREALSRLRELCHQWLRPETHTKEQILELLVLEQFLTILPEELQAWVQEQHPESGEEVVTVL 121  human
O14709         38 WETSHLHFRQLRYHETSGPQEALSRLRELCRRWLRPEARTKAQILELLVLEQFLSILPGEIRTWVQLHHPGSGEEAVALV 117  human
O60304         46 PETFRQLFRLFCYQEVAGPREALSRLWELCCRWLRPELRTKEQILELLVLEQFLTVLPGEIQARVREQQPESGEEAVVLV 125  human
O14771         41 SEACRQRFRQFCYGDVHGPHEAFSQLWELCCRWLRPELRTKEQILELLVLEQFLTVLPGEIQGWVREQHPGSGEEAVALV 120  human
O70162        120 LEAARLRFRCFRYEDAIGPQEALAQLRELCHQWLRPEVHSKEQVLELLVLEQFLGALPPEIQAQVQGQWPGSPEEAAALV 199  house mouse
Q15636         50 QELFRQLFRQLRYHESSGPLETLSRLRELCRWWLRPDVLSKAQILELLVLEQFLSILPGELRVWVQLHNPESGEELWPCW 129  human
CAC21447       42 lETSHQNFRRFRYQEAASPREALIRLRELCHQWLRPERRTKEQILELLVLEQFLTVLPGELQSWVRGQRPESGEEAVTLV 121  human
BAG51370       46 FETFYQRFRHFQYHEASGPREALSQLRVLCCEWLRPELHTKEQILELLVLEQFLTILPEEFQPWVREHHPESGEEAVAVI 125  human
NP_005732      37 pEASHLRFRRFRFQEAAGPREALSRLQELCHGWLRPEMRTKEQILELLVLEQFLTILPQEIQSRVQELHPESGEEAVTLV 116  human
XP_001166927   42 PELCRQSFRRFCYQEVSGPQEALSQLRQLCRQWLQPELHTKEQILELLVMEQFLTILPPEIQARVRHRCPMSSKEIVTLV 121  chimpanzee
O43309        122 EDLERELDEPGEQVSVHTGEQEMFLQETVRLRK 154  human
O14709        118 EELQKDLDGPAIQVPVLVKDQDTLQKVVSAPGT 150  human
O60304        126 EGLQRKPRKHR------QRGSELLSDDEVPLGI 152  human
O14771        121 EDLQKQPVK--------AWRQDVPSEEAEPEAA 145  human
O70162        200 DRLRWELDGPRKWVTVQVQGKEVLSEKMEPSSF 232  house mouse
Q15636        130 RSCRGTLMGHPGGTRALPEPRCALDGYRSLRSA 162  human
CAC21447      122 EGLQKQPRRPRRWVTVHVHGQEVLSEETVHLGA 154  human
BAG51370      126 ENIQRELEERRQQIVACP---DVLPRKMATPGA 155  human
NP_005732     117 EDMQRELGRLRQQVTNHGRGTEVLLEEPLPLET 149  human
XP_001166927  122 EDFHRASKKPKQWVAVCMQGQKVLLEKTGSQlg 154  chimpanzee
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap