3NQU,3AFA


Conserved Protein Domain Family
H3

?
smart00428: H3 
Click on image for an interactive view with Cn3D
Histone H3
Statistics
?
PSSM-Id: 128705
View PSSM: smart00428
Aligned: 10 rows
Threshold Bit Score: 161.462
Threshold Setting Gi: 729678
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3NQU_A        33 LGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRg-vDFNWQAQALLALQEAAEAFLVHLFEDAYL 111 human
XP_002930274  73 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT---DLRFQSSAVMALQEACEAYLVGLFEDTNL 149 giant panda
NP_499073    156 NRISKTRRYRPGQKALEEIRKYQESEDLLIPKAPFARLVREIMQTSTPfssDLRIRSDAINALQEASEALLVQMFDGSSL 235 nematode
NP_031707     28 VGSQTLRR-RQKFMWLKEIKTLQKSTDLLFRKKPFSMVVREICEKFSRg-vDFWWQAQALLALQEAAEAFLIHLFEDAYL 105 house mouse
NP_499128    183 NRVTKTRRYRPGQKALEEIRKYQKTEDLLIQKAPFARLVREIMQTSTPfgaDCRIRSDAISALQEAAEAFLVEMFEGSSL 262 nematode
NP_012875    124 SLKRVEKKYTPSELALYEIRKYQRSTDLLISKIPFARLVKEVTDEFTTkdqDLRWQSMAIMALQEASEAYLVGLLEHTNL 203 Saccharomyces c...
P40285        28 GVKRSHRRWRPGTCAIREIRKFQKSTSLLIQCAPFQRLVR-GVERQKE---GLRFQSSAIMALQEATEAYIVSLMADTNL 103 Leishmania infa...
XP_651659     33 KDSTKKKRAHPGAVALTEIKVLQRSTELLLRKAPFQALVREIAQVSKS---DLRFQSAAISALQEAAEAYLVGLFEDTNL 109 Entamoeba histo...
T34322        58 KSKTLCTLMYDRTVALREIRRYQKSTELLIRRAPFQRLVREIAQDFKT---DLRFQSSAVMALQEAAEAYLVGLFEDTNL 134 nematode
3AFA_A        37 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT---DLRFQSSAVMALQEACEAYLVGLFEDTNL 113 human
3NQU_A       112 LTLHAGRVTLFPKDVQLARRIRGLEE 137 human
XP_002930274 150 CAIHAKRVTIMPKDIQLARRIRGERA 175 giant panda
NP_499073    236 ISAHSKRATLTTTDVQLYRRLCLPNL 261 nematode
NP_031707    106 LSLHAGRVTLFPKDIQLTRRIRGFEG 131 house mouse
NP_499128    263 ISTHAKRVTLMTTDIQLYRRLCLRHL 288 nematode
NP_012875    204 LALHAKRITIMKKDMQLARRIRGQFI 229 Saccharomyces cerevisiae S288c
P40285       104 ACIHAKRVTIQPKDIQLALRLRGERH 129 Leishmania infantum
XP_651659    110 CAIHAKRITIMPKDMQLARRIRGERT 135 Entamoeba histolytica HM-1:IMSS
T34322       135 CAIHAKRVTIMPKDIQLARRIRGERA 160 nematode
3AFA_A       114 CAIHAKRVTIMPKDIQLARRIRGERA 139 human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap