2HZD


Conserved Protein Domain Family
TEA

?
smart00426: TEA 
Click on image for an interactive view with Cn3D
TEA domain
Statistics
?
PSSM-Id: 128703
View PSSM: smart00426
Aligned: 7 rows
Threshold Bit Score: 119.29
Threshold Setting Gi: 290878097
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2HZD_A         4 DAEGVWSPDIEQSFQEALSIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVL 71  human
NP_001161650  27 DAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVL 94  Saccoglossus kowalevskii
CBK39156     127 IGCDKWSEKVEEAFLEALRLIMKNGTTKIKIRNAN--FGRNELISLYIKHKTNEFRTKKQISSHIQVW 192 Saccharomyces cerevisiae EC...
NP_495186     75 DAEGVWSIDIDQAFQEALAIYPPCGRRKIIISDEGKMYGRNELIARYIKLRCGKTRTRKQVSSHIQVL 142 nematode
Q90701        30 DAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTKKQVSSHLQVL 97  chicken
XP_658026    135 DGEPVWSDELEDAFQQALEANPPMGRR--KWSERGKSYGRNELIAEYIYKLTGKRRTRKQVSSHLQVL 200 Aspergillus nidulans FGSC A4
NP_001100982  40 DAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVL 107 Norway rat
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap