Conserved Protein Domain Family

smart00424: STE 
STE like transcription factors
PSSM-Id: 128701
Aligned: 5 rows
Threshold Bit Score: 231.237
Threshold Setting Gi: 2826519
Created: 12-Jul-2011
Updated: 2-Oct-2020
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
CAY80094     137 SFLFRNMCLKTQKKQKVFFWFSVAHDKLFAD 167 Saccharomyces cerevisiae EC1118
XP_454722    131 AFLYKNMCLKTQKKQKVFFWFSVPHDRLFAD 161 Kluyveromyces lactis NRRL Y-1140
XP_002417345 124 EFLFKNSCLRTQKKQKVFFWFNVPHDKLMAD 154 Candida dubliniensis CD36
XP_001398387 135 DFLYKNNCIRTQKKQKVFYWYSVPHDRLFLD 165 Aspergillus niger CBS 513.88
AAC01955     170 DLLFRNGCIRTQKKQKVFYWFSVPHDRLFLD 200 Cryptococcus neoformans var. neoformans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap