1CO4


Conserved Protein Domain Family
Cu_FIST

?
smart00412: Cu_FIST 
Click on image for an interactive view with Cn3D
Copper-Fist
binds DNA only in present of copper or silver
Statistics
?
PSSM-Id: 128690
View PSSM: smart00412
Aligned: 9 rows
Threshold Bit Score: 67.8298
Threshold Setting Gi: 5542205
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1CO4_A         2 VVINGVKYACDSCIKSHKAAQCEHNDRPLK-ILKPRGRPP 40  Candida glabrata
EEU05332       2 VLINGIKYACERCIRGHRVTTCNHTDQPLM-MIKPKGRPS 40  Saccharomyces cerevisiae JAY291
CAA52645       2 IIFNGNKYACASCIRGHRSSTCRHSHRMLI-KVRTRGRPS 40  baker's yeast
NP_592923      2 VVINNVKMACMKCIRGHRSSTCKHNDRELF-PIRPKGRPI 40  Schizosaccharomyces pombe 972h-
XP_500631      2 VVIEGIKYACERCIRGHRVSSCTHTQQPLI-RIKPKGRPA 40  Yarrowia lipolytica CLIB122
EGA58725       2 VVINGVKYACETCIRGHRAAQCTHTDGPLQ-MIRRKGRPS 40  Saccharomyces cerevisiae FostersB
NP_588223      2 IIIDGKNYACVVCLRGHRGSSCQHQERALI-EVRTRGRPL 40  Schizosaccharomyces pombe 972h-
XP_447430      2 VVINGVKYACDSCIKSHKAAQCEHNDRPLK-ILKPRGRPP 40  Candida glabrata CBS 138
XP_001905929   2 PIINGQKMACGPCIRGHRSTKCNHYNERVMvPVRKPGRPL 41  Podospora anserina DSM 980
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap