
Conserved Protein Domain Family

smart00412: Cu_FIST 
Click on image for an interactive view with Cn3D
binds DNA only in present of copper or silver
PSSM-Id: 128690
Aligned: 9 rows
Threshold Bit Score: 67.8298
Threshold Setting Gi: 5542205
Created: 12-Jul-2011
Updated: 2-Oct-2020
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
EEU05332       2 VLINGIKYACERCIRGHRVTTCNHTDQPLM-MIKPKGRPS 40  Saccharomyces cerevisiae JAY291
NP_592923      2 VVINNVKMACMKCIRGHRSSTCKHNDRELF-PIRPKGRPI 40  Schizosaccharomyces pombe 972h-
EGA58725       2 VVINGVKYACETCIRGHRAAQCTHTDGPLQ-MIRRKGRPS 40  Saccharomyces cerevisiae FostersB
NP_588223      2 IIIDGKNYACVVCLRGHRGSSCQHQERALI-EVRTRGRPL 40  Schizosaccharomyces pombe 972h-
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap