Conserved Protein Domain Family
ZnF_CHCC

?
smart00400: ZnF_CHCC 
zinc finger
Statistics
?
PSSM-Id: 128681
View PSSM: smart00400
Aligned: 17 rows
Threshold Bit Score: 93.8962
Threshold Setting Gi: 9630442
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EGK18265      36 FHACCPFHNEKTPSFTVNGEKQFYHCFGCGAHGNAIDFLMNYDKLEFVETVEELA 90  Shigella flexneri VA-6
ADZ63124      35 YIGLCPFHGEKTPSFNVNAEKGFYHCFGCGRSGDAIEFLKEYNQVGFVDAVKELA 89  Lactococcus lactis subsp. lactis CV56
P71481        36 HIACCPFHNEKTPSFNVVAKKQFYHCFGCGASGNAISFVMNYLNQGFTDAVETLr 90  Legionella pneumophila
YP_400309     37 FVGLCPFHDDKSPSFTVSPAKQFYYCFSCGAGGNPIKFLMELGKQSFSEVVLDLA 91  Synechococcus elongatus PCC 7942
AEJ47358      37 LKGLCPFHNEKSPSFHVRPNHGHFHCFGCGEGGDVYAFIQKIEHVSFVEAVELLA 91  Mycobacterium tuberculosis CCDC5079
NP_441549     37 HLGLCPFHDEKSPSFSVSPAKQMYYCFGCGAGGNAFNFLMELGKRSFTDVALDLA 91  Synechocystis sp. PCC 6803
YP_003927943  33 YMACCPFHEERSASFSVNQIKGFYHCFGCGASGDSIKFVMAFEKLSFVEALEKLA 87  Helicobacter pylori SJM180
NP_072915     35 LLALCPFHDDKNPSMSISSSKNIFKCWACNAAGNGIAFIQKHDQLDWKTALKKAI 89  Mycoplasma genitalium G37
NP_110041     34 FVALCPFHADQNPSMTVSVAKNIFKCFSCQVGGDGIAFIQKIDQVDWKTALNKAl 88  Mycoplasma pneumoniae M129
YP_067784     34 YVGLCPFHQEKTPSFTVSDSKRFFYCFGCKASGDVIKFTSNISGLSYNESAIKLA 88  Rickettsia typhi str. Wilmington
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap