1K78


Conserved Protein Domain Family
PAX

?
smart00351: PAX 
Click on image for an interactive view with Cn3D
Paired Box domain
Statistics
?
PSSM-Id: 128645
View PSSM: smart00351
Aligned: 19 rows
Threshold Bit Score: 175.588
Threshold Setting Gi: 74965747
Created: 13-Jul-2011
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1K78_A        16 GHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIKPGVIGGS-KPK-VATP 93  human
Q09546        13 GQGRVNQLGGVFINGRPLPIHVRHAIISMAKKGIKPCHISRQLKVSHGAVSKILNRYAETGSISPGQIGGSpRAR-LTVQ 91  Caenorhabditis ...
Q20551        97 RSSGRNQLGRTYSPGLPLSMCEREEIVKLFQGGWKICDISKRLCVTHSCVSKILNRYRQTGSVKPK---DA-KEG-RTES 171 Caenorhabditis ...
AAD50904       2 SHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGS-KPR-VATP 79  axolotl
NP_852124     34 GQGRVNQLGGVFINGRPLPNHIRHKIVEMAHHGIRPCVISRQLRVSHGCVSKILCRYQETGSIRPGAIGGS-KPKqVTTP 112 human
BAE21998       4 tYGEVNQLGGVFVNGRPLPNAIRLRIVELAQLGIRPCDISRQLRVSHGCVSKILARYNETGSILPGAIGGS-KPR-VTTP 81  house mouse
NP_001024570   5 GHTGVNQLGGVFVNGRPLPDATRQRIVDLAHKGCRPCDISRLLQVSNGCVSKILCRYYESGTIRPRAIGGS-KPR-VATS 82  nematode
CAA09227      20 GHSGINQLGGIFVNGRPLPDVTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGS-KPR-VATN 97  Girardia tigrina
XP_002083072  19 GQGRVNQLGGVFINGRPLPNHIRRQIVEMAAAGVRPCVISRQLRVSHGCVSKILNRFQETGSIRPGVIGGS-KPR-VATP 96  Drosophila simu...
AAF14073       5 GLSSVNQLGGLFVNGRPLPLDTRQQIVQLAIRGMRPCDISRSLKVSNGCVSKILGRYYRTGVLEPKCIGGS-KPR-LATP 82  house mouse
1K78_A        94 KVVEKIAEYKRQNPTMFAWEIRDRLLAERVCDNDTVPSVSSINRIIR 140 human
Q09546        92 AVEKEILIACDENPQMSAAELRDWLIHKDICTKGNAPTVPAIKRLIG 138 Caenorhabditis elegans
Q20551       172 PLVLAVRDYRSRLGMCRQSEIREQLIRDGVCTRDNAPSRSSINHilr 218 Caenorhabditis elegans
AAD50904      80 EVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLR 126 axolotl
NP_852124    113 DVEKKIEEYKRENPGMFSWEIRDKLLKDAVCDRNTVPSVSSISRILR 159 human
BAE21998      82 NVVKHIRDYKQGDPGIFAWEIRDRLLADGVCDKYNVPSVSSISRILR 128 house mouse
NP_001024570  83 DVVEKIEDYKRDQPSIFAWEIRDKLLADNICNNETIPSVSSINRVLR 129 nematode
CAA09227      98 TVVRKVTIYKQESPSMFAWEIRDRPLQDGVCNQDNLPSISSINRILR 144 Girardia tigrina
XP_002083072  97 DIESRIEELKQSQPGIFSWEIRAKLIEAGVCDKQNAPSVSSISRLLR 143 Drosophila simulans
AAF14073      83 AVVARIAQLKDEYPALFAWEIQHQLCTEGLCTQDKAPSVSSINRVLR 129 house mouse
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap