Conserved Protein Domain Family
HALZ

?
smart00340: HALZ 
homeobox associated leucin zipper
Statistics
?
PSSM-Id: 128634
View PSSM: smart00340
Aligned: 11 rows
Threshold Bit Score: 69.7884
Threshold Setting Gi: 75102369
Created: 13-Jul-2011
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q39862       169 KQTEVDCEFLKRCCENLTEENRRLQKEVQELRALKLSPQFYMHM 212 soybean
Q39927       150 KQTEVDCEYLKRCCNTLTDENQRLRQEVQELKAQKVSPALYMQL 193 common sunflower
Q40691       212 KQTEVDCELLKRCCETLTDENRRLHRELQELRALKLATAAAAPH 255 Oryza sativa Indica Group
O65770       203 KQTEVDYALLKKCCETLTEENRKLQKEVQELKALKLAQSPLYMH 246 Craterostigma plantagineum
XP_002873274 245 KQTEVDCEYLKRCCESLTEENRRLQKEVKELRTLKTSTPFYMQL 288 Arabidopsis lyrata subsp. lyrata
NP_179865    168 KQTEVDCEFLKKCCETLADENIRLQKEIQELKTLKLTQPFYMHM 211 thale cress
BAA34236     248 KQTEVDCELLKRCCESLTEENRRLQKEVAELRALKGGSPLCYIP 291 Ceratopteris richardii
BAA34237     113 KQTEVDCELLKRCCESLTEENRRLQKEVQELRALKVTAPRVIAH 156 Ceratopteris richardii
AAM64872     190 KQTEVDCEYLKRCVEKLTEENRRLEKEAAELRALKLSPRLYGQM 233 thale cress
NP_178252    194 KQTEMECEYLKRWFGSLTEENHRLHREVEELRAMKVGPTTVNSA 237 thale cress
BAA34243     134 KQTEVDCELLRKCCASLTEENRRLQMEVDQLRALSTTQLHFSDF 177 Ceratopteris richardii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap