Conserved Protein Domain Family

smart00340: HALZ 
homeobox associated leucin zipper
PSSM-Id: 128634
Aligned: 11 rows
Threshold Bit Score: 69.7884
Threshold Setting Gi: 75102369
Created: 13-Jul-2011
Updated: 2-Oct-2020
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
O65770       203 KQTEVDYALLKKCCETLTEENRKLQKEVQELKALKLAQSPLYMH 246 Craterostigma plantagineum
XP_002873274 245 KQTEVDCEYLKRCCESLTEENRRLQKEVKELRTLKTSTPFYMQL 288 Arabidopsis lyrata subsp. lyrata
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap