2D4U,2LIG


Conserved Protein Domain Family
TarH

?
smart00319: TarH 
Click on image for an interactive view with Cn3D
Homologues of the ligand binding domain of Tar
Homologues of the ligand binding domain of the wild-type bacterial aspartate receptor, Tar.
Statistics
?
PSSM-Id: 128614
View PSSM: smart00319
Aligned: 12 rows
Threshold Bit Score: 116.026
Threshold Setting Gi: 126840
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2D4U_A        24 QTIRQQQSTLNGSWVALLQTRNTLNRAGIRY--MmdQNNIGS-----G--STvaE-LMESA-SIS-LKQAEKNWADYEAL 91  Escherichia coli
AAA97252      44 QTIRQQQSTLNGSWVALLQTRNTLNRAGIRY--MmdQNNIGS-----G--STvaE-LMESA-SIS-LKQAEKNWADYEAL 111 Escherichia col...
P21822        44 QTIRQQQLLLSESRVDLLQARNSLNRAGIRY--MmdTNKIGS-----G--ATidE-LLAKAeKEK-LARAERNYTAYEKI 112 Enterobacter ae...
YP_002637375 121 NELRQQQSELTSTWDLMLQTRINLSRSAARM--MmdASNQQS-----S--AK--TdLLQNA-KTT-LAQAAAHYANFKNM 187 Salmonella ente...
YP_002217536  43 SALSYQQQELGGSFQTLIETRVTINRVAIRMlkN--QRDPAS-----LdaMN--T-LLTNA-GAS-LNEAEKHFNNYVNS 110 Salmonella ente...
ACD62811      25 DRDQRDVTAEIEIRTGLANSSDFLRSARINM--I--QAGAASriaemE--AM--K-RNIAQ-AESeIKQSQQGYRAYQNR 94  Escherichia coli
CAB07929      36 EFSSYRSASGKLDQEIMGNAKNSVDTFNTTV-----TNDLGE-----K--A---K-AVTFF-SES-LKRSAFKGKSN--- 94  Bacillus subtil...
AAA20556      33 AIFAYQSASSSLDRQMMGSALENVQQLNEII--N---TSIGE-----K---E--N-SADYF-SEW-LTKEKYNAKSN--- 91  Bacillus subtilis
P21823        43 lPSVASTDALSLSWVSLLQARNTLNRAGTRG--A--EGAAGA-----G--GS--A-LMAAP-AAR-CKKPISILTSSS-- 104 Enterobacter ae...
NP_391001     33 AYFSYQSAWNALDRELISSAKGNVEELNSTL-----QNKLED-----K--V---K-AIDYY-SET-VDKDILLGKNK--- 91  Bacillus subtil...
AAA23567      44 EQSNQQRAALAQTRAVMLQASTALNKAGTLT--A--LSYPAD-----D--IK--T-LMTTA-RAS-LTQSTTLFKSFMAM 107 Escherichia coli
2LIG_A        20 NELRQQQSELTSTWDLMLQTRINLSRSAARM--MmdASNQQS-----S--AK--TdLLQNA-KTT-LAQAAAHYANFKNM 86  Salmonella ente...
2D4U_A        92 PRDPRQSTAAAAEIKRNYDIYHNALAELIQLLGAG-KINEFFDQPTQGYQDGFEKQYVAYMEQNDRLHDIAV 162 Escherichia coli
AAA97252     112 PRDPRQSTAAAAEIKRNYDIYHNALAELIQLLGAG-KINEFFDQPTQGYQDGFEKQYVAYMEQNDRLHDIAV 182 Escherichia coli str. K...
P21822       113 PQDPRQDPQATEKLKQQYGILYGALSELIQLLGGGcKINAFFDQPTQKYQDDFEQTYNAYLQQNGKLYQIAV 184 Enterobacter aerogenes
YP_002637375 188 TPLP-AMAEASANVDEKYQRYQAALAELIQFLDNG-NMDAYFAQPTQGMQNALGEALGNYARVSENLYRQTF 257 Salmonella enterica sub...
YP_002217536 111 EAIAGKDPALDAQAEASFKQMYDVLQQSIHYLKAD-NYAAYGNLDAQKAQDDMEQVYDQWLSQNAQLIKLAS 181 Salmonella enterica sub...
ACD62811      95 PVKTPADEALDTELNQRFQAYITGMQPMLKYAKNG-MFEAIINHE-SEQIRPLDNAYTDILNKAVKIRSTRA 164 Escherichia coli
CAB07929      95 ----------QEEIKAKFSQYVSINQGVARIYGGA-DNGTYVQAPKEKLPEGYDPRQRPWYQDAMKAGGEIV 155 Bacillus subtilis subsp...
AAA20556      92 -----------ASIREKFSQYISINKDVESIYTSD-TKGHFTRYPDLPMPSGYNPVERDWYKKAVANKGKVV 151 Bacillus subtilis
P21823       105 TRLARMSRNSSWPMPRVIATRIYALRELIVFLENR-NLQAFMDQPTQKIQDRFEADFVQYLQLAKATTDEAS 175 Enterobacter aerogenes
NP_391001     92 -----------TLLKEKFKQYTTLNDDVGAIYAAS-EDKKLYKYPDSGVPKGFDPTGRDWYKQAVAEKGQAV 151 Bacillus subtilis subsp...
AAA23567     108 TAGNEHVRGLQKETEKSFARWHNDLEHQATWLESN-QLSDFLTAPVQGSQNAFDVNFEAWQLEINHVLEAAS 178 Escherichia coli
2LIG_A        87 TPLP-AMAEASANVDEKYQRYQAALAELIQFLDNG-NMDAYFAQPTQGMQNALGEALGNYARVSENLYRQTF 156 Salmonella enterica sub...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap