Conserved Protein Domain Family
OLF

?
smart00284: OLF 
Olfactomedin-like domains
Statistics
?
PSSM-Id: 128580
View PSSM: smart00284
Aligned: 4 rows
Threshold Bit Score: 423.86
Threshold Setting Gi: 585611
Created: 13-Jul-2011
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAD05330   205 GLLKGVYQSEHLFESD---H---QSGAWCKDPLQAS----DKIYYMPWTP--YRTDTLTEYSSKDDFIAGRPTTTYKLPH 272  cattle
BAA34199   244 GVLMWVGEPVTLRTAEtitG---KYGVWMRDPKPTHpytqETTWRIDTVG--TGIRQVFEYSQISQFEQGYPSKVHVLPQ 318  Norway rat
NP_446025  228 GKLTGISDPVTVKTSG---S---RFGSWMTDPLAPEg--dNRVWYMDGY---HNNRFVREYKSMVDFMNTDNFTSHRLPH 296  Norway rat
Q07081     196 QGLAHISKPNLMQLNWk--GnayKSGAWGKDAAWNTtk-kSLYWVAPLNTdgRVLESIRIYPSMSDLQMYKNPIDLPLSM 272  bullfrog
AAD05330   273 ----------RVDGTGFVVYDGALFFNKERTRNIVKFDLRTRIKSGEAIIANANYHDTSPYRWGGKSDIDLAVDENGLWV 342  cattle
BAA34199   319 ----------ALESTGAVVYAGSLYFQGAESRTVLRYELNTETVKAEKEIPGAGYHGQFPYAWGGYTDIDLAVDESGLWV 388  Norway rat
NP_446025  297 ----------PWSGTGQVVYNGSIYFNKFQSHIIIRFDLKTETILKTRSLDYAGYNNMYHYAWGGHSDIDLMVDENGLWA 366  Norway rat
Q07081     273 liknklnntfAGQGAGVVVHNNNLYYNCFNSHDMCRASLTSGVYQKKPLLN-ALFNNRFSYAGTMFQDMDFSSDEKGLWV 351  bullfrog
AAD05330   343 IYATEQNNGKIVISQLNPYTLRIEGTWDTAYDKRSASNAFMICGILYVVKSvyedddNEATGNKIDYIYNTDQSKDSLVD 422  cattle
BAA34199   389 IYSTEETRGAIVLSKLNPENLELESTWETNIRKQSVANAFVICGILYTVSS------YSSVHATINFAYDTNTGISKTLT 462  Norway rat
NP_446025  367 VYATNQNAGNIVISKLDPVSLQILQTWNTSYPKRSAGEAFIICGTLYVTN-------GYSGGTKVHYAYQTNASTYEYID 439  Norway rat
Q07081     352 IFTTEKSAGKIVVGKVNVATFTVDNIWITTQNKSDASNAFMICGVLYVTRS------LGPKMEEVFYMFDTKTGKEGHLS 425  bullfrog
AAD05330   423 VPFPNSYQYIAAVDYNPRDNLLYVWNNYHVVKYSLDFGP 461  cattle
BAA34199   463 IPFKNRYKYSSMVDYNPLERKLFAWDNFNMVTYDIKLSE 501  Norway rat
NP_446025  440 IPFQNKYSHISMLDYNPKDRALYAWNNGHQTLYNVTLFH 478  Norway rat
Q07081     426 IMMEKMAEKVHSLSYNSNDRKLYMFSEGYLLHYDIALKP 464  bullfrog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap