Conserved Protein Domain Family
NEBU

?
smart00227: NEBU 
The Nebulin repeat is present also in Las1.
Tandem arrays of these repeats are known to bind actin.
Statistics
?
PSSM-Id: 128523
View PSSM: smart00227
Aligned: 107 rows
Threshold Bit Score: 26.6596
Threshold Setting Gi: 57208758
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O35884    483 YTLPQDAPQLLKAKANAELFSEVKYKEGWQK 513  house mouse
CAI41194   86 YKRMPATIDSVFAGEVTQLQSEVAYKQKHDA 116  human
EDL01752  253 FPAMI-TPAYQIAKRATELASDVRYHQQYHR 282  house mouse
BAE23819  264 SLAAQDNLVLKRAQSVSKLVSENKYKENYQT 294  house mouse
AAC53323  168 FPAMI-TPAYQRAKAANQLASQVQYKRGHDE 197  house mouse
AAI10453  139 YAHMKEPPEVKHAMEVNKHQSNISYRKDVQD 169  human
EAW86173  207 EPAVIGRPDFEHAVEASKLSSQIKYKEKFDN 237  human
AAH29384  148 CHVDEKAKDIEHAKKVSQQVSKVLYKQNWED 178  human
EAW86173  527 MQVSMDIPDILRAKRTSEIYSQRKYKDEAEK 557  human
AAC53323  307 FPAMI-TPAYQTAKKANELVSDIKYRQDFHK 336  house mouse
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap