1XHM,2PBI


Conserved Protein Domain Family
GGL

?
smart00224: GGL 
Click on image for an interactive view with Cn3D
G protein gamma subunit-like motifs
Statistics
?
PSSM-Id: 128520
View PSSM: smart00224
Aligned: 29 rows
Threshold Bit Score: 60.3682
Threshold Setting Gi: 6322545
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1XHM_B        15 IAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAIL 77  cattle
EAW65665     104 IAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAIL 166 human
NP_034446     13 IGQARKMVEQLKIEASLCRIKVSKAAADLMTYCDAHACEDPLITPVPTSENPFREKKFFCALL 75  house mouse
XP_849303     43 ISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPASENPFREKKFFCTIL 105 dog
NP_077052      8 VAQARKLVEQLRIEAGIERIKVSKASSELMSYCEQHARNDPLLVGVPASENPFK-DKKPCIIL 69  Norway rat
NP_777210     11 IAQARRTVQQLRMEASIERIKVSKASADLMSYCEEHARNDPLLMGIPTSENPFK-DKKTCTIL 72  cattle
NP_631924      8 IAEARKTVEQLKLEVNIDRMKVSQAAAELLAFCETHAKDDPLVTPVPAAENPFRDKRLFCTLL 70  Norway rat
AAP36465       7 VAAMKKVVQQLRLEAGLNRVKVSQAAADLKQFCLQNAQHDPLLTGVSSSTNPFRPQKV-CSFL 68  synthetic construct
XP_003312268  90 ASALQRLVEQLKLEAGVERIKVSQAAAELQQYCMQNACKDALLVGVPAGSNPFRE-PRSCALL 151 chimpanzee
NP_510145      1 MENIKASTEQLCAEANIQRKKVSEVSKELLDFCEKNKTNDMLVSGPTDQHNPFQE-KKSCSVL 62  nematode
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap