3G5B


Conserved Protein Domain Family
ZU5

?
smart00218: ZU5 
Click on image for an interactive view with Cn3D
Domain present in ZO-1 and Unc5-like netrin receptors
Domain of unknown function.
Statistics
?
PSSM-Id: 128514
View PSSM: smart00218
Aligned: 10 rows
Threshold Bit Score: 136.712
Threshold Setting Gi: 20043235
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3G5B_A          1 PGSSVSGTFGCLGGRLTIPG-TGVSLLVPNGAIPQGKFYDLYLRINKTESTLPLS--EGSQTVLSPSVTCGP-------T 70   Norway rat
AAB57678      495 TSNMAYGTFNFLGGRLMIPN-TGISLLIPPDAIPRGKIYEIYLTLHKPEDVRLPL--AGCQTLLSPVVSCGP-------P 564  Norway rat
AAB57679      541 PSSSVSGTFGCLGGRLTIPG-TGVSLLVPNGAIPQGKFYDLYLRINKTESTLPLS--EGSQTVLSPSVTCGP-------T 610  Norway rat
NP_001104253  952 TGFLVSFMVDARGGSMRGSRhNGLRVVIPPRTCAAPTRITCRLVKPQKLNTPPPL--AEEEGLASRIIALGP-------T 1022 house mouse
2003319A      966 SGFLVIFMVDARGGAMRGCRhNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPM--VEGEGLASRLIEVGP-------S 1036 human
NP_001021266 1000 PSFLISFLVDARGGAMRGCRhSGVRIIVPPRKASQPIRVTCRYLRKDKLAHPPPL--SEGEELASRILEMAP-------A 1070 nematode
AAB54103      528 PSCTAFGTFNSLGGHLIIPN-SGVSLLIPAGAIPQGRVYEMYVTVHRKENMRPPM--EDSQTLLTPVVSCGP-------P 597  house mouse
NP_787123     930 LGFLVSFLVDARGGSMRGYRhNGVRIIVPPKACAEPTRITCRYVKPQRVVNPPPL--MEGEALVSRILEMSP-------V 1000 fruit fly
XP_002749107 1632 VVATARGIFNSNGGVLSSIE-TGVSIIIPQGAIPEGVEQEIYFKVCRDNSILPPLdkEKGETLLSPLVMCGP-------H 1703 white-tufted-...
AAB23867      528 SQNIVAAQIDSNGARLSLSK-SGARLIVPELAVE--GEKMLYLAVSDTLTDQPHL--KPIESALSPVIVIGQcdvsmsaH 602  nematode
3G5B_A         71 GLLLCRPVVLTVPHCAEVIAGD-WIFQLKTQAHQG 104  Norway rat
AAB57678      565 GVLLTRPVILAMDHCGEPSPDS-WSLRLKKQSCEG 598  Norway rat
AAB57679      611 GLLLCRPVVLTVPHCAEVIAGD-WIFQLKTQAHQG 644  Norway rat
NP_001104253 1023 GAQFLSPVIVEIPHFASHGRGD-RELVVLRSENGS 1056 house mouse
2003319A     1037 GAQFLGPVIVEIPHFAALRGKE-RELVVLRSENGD 1070 human
NP_001021266 1071 GAKFLGPVILEVPHFASLRDRE-REIVILRSDDGQ 1104 nematode
AAB54103      598 GALLTRPVILTLHHCADPSTED-WKIQLKNQAVQG 631  house mouse
NP_787123    1001 DGMFLSPITLEVPHYGTLRKNE-REIIILRSDNGE 1034 fruit fly
XP_002749107 1704 GLKFLKPVELRLPHCDPKTWQNkCLPGDPNYLVGA 1738 white-tufted-ear marmoset
AAB23867      603 DNILRRPVVVSFRHCASTFPRDnWQFTLYADEGSG 637  nematode
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap