1UEA,1GXD


Conserved Protein Domain Family
NTR

?
smart00206: NTR 
Click on image for an interactive view with Cn3D
Tissue inhibitor of metalloproteinase family.
Form complexes with metalloproteinases, such as collagenases, and irreversibly inactivate them.
Statistics
?
PSSM-Id: 128502
View PSSM: smart00206
Aligned: 23 rows
Threshold Bit Score: 293.989
Threshold Setting Gi: 193042
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1UEA_B         1 CTCVPPHPQTAFCNSDLVIRAKFVGTPEVAQT-------TLYQRYEIKMTKMYKGFQALGDaadIRFVYTPAMESVCGYF 73  human
P25785        27 CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGndiygnpIKRIQYEIKQIKMFKGPDK--D---IEFIYTAPSSAVCGVS 101 house mouse
NP_990818     25 CTCVPIHPQDAFCNSDIVIRAKVVGKKLMKDGp------FGTMRYTVKQMKMYRGFQIMPH---VQYIYTEASESLCGVK 95  chicken
P16368        27 CSCSPVHPQQAFCNADIVIRAKAVNKKEVDSGndiygnpIKRIQYEIKQIKMFKGPDQ--D---IEFIYTAPAAAVCGVS 101 cattle
XP_001146829  27 CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGndiygnpIKRIQYEIKQIKMFKGPEK--D---IEFIYTAPSSAVCGVS 101 chimpanzee
NP_003246     27 CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGndiygnpIKRIQYEIKQIKMFKGPEK--D---IEFIYTAPSSAVCGVS 101 human
Q60453         3 CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGndiygnpIKRIQYEIKQIKMFKGPDK--D---IEFIYTAPSSAVCGVS 77  long-tailed ham...
NP_035725     24 CTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGp------FGTLVYTIKQMKMYRGFSKMPH---VQYIHTEASESLCGLK 94  house mouse
P48032        24 CTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGp------FGTLVYTIKQMKMYRGFSKMPH---VQYIHTEASESLCGLK 94  Norway rat
AAX43504      30 CSCAPAHPQQHICHSALVIRAKISSEKVVPASadp-adtEKMLRYEIKQIKMFKGFEKVKD---VQYIYTPFDSSLCGVK 105 synthetic const...
1UEA_B        74 HRSHArSEEFLIAGKLQ-DGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEeCTVFPCLSIPCKLQSGTHCLWTDQLL 152 human
P25785       102 LDVGG-KKEYLIAGKAEgDGKMHITLCDFIVPWDTLSITQKKSLNHRYQMGCE-CKITRCPMIPCYISSPDECLWMDWVT 179 house mouse
NP_990818     96 LEV-N-KYQYLITGRVY-EGKVYTGLCNWYEKWDRLTLSQRKGLNHRYHLGCG-CKIRPCYYLPCFATSKNECIWTDMLS 171 chicken
P16368       102 LDIGG-KKEYLIAGKAEgNGNMHITLCDFIVPWDTLSATQKKSLNHRYQMGCE-CKITRCPMIPCYISSPDECLWMDWVT 179 cattle
XP_001146829 102 LDVGG-KKEYLIAGKAEgDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCE-CKITRCPMIPCYISSPDECLWMDWVT 179 chimpanzee
NP_003246    102 LDVGG-KKEYLIAGKAEgDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCE-CKITRCPMIPCYISSPDECLWMDWVT 179 human
Q60453        78 LDVGG-KKEYLIAGKAEgDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCE-CKITRCPMIPCYISSPDECLWMDWVT 155 long-tailed ham...
NP_035725     95 LEV-N-KYQYLLTGRVY-EGKMYTGLCNFVERWDHLTLSQRKGLNYRYHLGCN-CKIKSCYYLPCFVTSKNECLWTDMLS 170 house mouse
P48032        95 LEV-N-KYQYLLTGRVY-EGKMYTGLCNFVERWDHLTLSQRKGLNYRYHLGCN-CKIKSCYYLPCFVTSKKECLWTDMLS 170 Norway rat
AAX43504     106 LEANS-QKQYLLTGQVLsDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHLNCG-CQITTCYTVPCTISAPNECLWTDWLL 183 synthetic const...
1UEA_B       153 QGSEKGFQSRHLACLPREPGLCTW 176 human
P25785       180 EKSINGHQAKFFACIKRSDGSCAW 203 house mouse
NP_990818    172 NFGHSGHQAKHYACIQRVEGYCSW 195 chicken
P16368       180 EKNINGHQAKFFACIKRSDGSCAW 203 cattle
XP_001146829 180 EKNINGHQAKFFACIKRSDGSCAW 203 chimpanzee
NP_003246    180 EKNINGHQAKFFACIKRSDGSCAW 203 human
Q60453       156 EKSINGHQAKFFACIKRSDGSCAW 179 long-tailed hamster
NP_035725    171 NFGYPGYQSKHYACIRQKGGYCSW 194 house mouse
P48032       171 NFGYPGYQSKHYACIRQKGGYCSW 194 Norway rat
AAX43504     184 ERKLYGYQAQHYVCMKHVDGTCSW 207 synthetic construct
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap