2AHN,1AUN


Conserved Protein Domain Family
THN

?
smart00205: THN 
Click on image for an interactive view with Cn3D
Thaumatin family
The thaumatin family gathers proteins related to plant pathogenesis. The thaumatin family includes very basic members with extracellular and vacuolar localization. Thaumatin itsel is a potent sweet-tasting protein. Several members of this family display significant in vitro activity of inhibiting hyphal growth or spore germination of various fungi probably by a membrane permeabilizing mechanism.
Statistics
?
PSSM-Id: 128501
View PSSM: smart00205
Aligned: 10 rows
Threshold Bit Score: 314.394
Threshold Setting Gi: 135780
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2AHN_A      3 ISFKNNCPYMVWPGTLTSdQKPQLSTTGFELASQASFQLDTPVPWN-GRFWARTGCSTDAsGKFVCATADCAsGqVMCNG 81  sweet cherry
NP_177641  26 FTLRNNCPTTVWAGTLAG-QGPKLGDGGFELTPGASRQLTAPAGWS-GRFWARTGCNFDAsGNGRCVTGDCG-G-LRCNG 101 thale cress
P50694     26 ISFKNNCPYMVWPGTLTSdQKPQLSTTGFELASQASFQLDTPVPWN-GRFWARTGCSTDAsGKFVCATADCAsGqVMCNG 104 sweet cherry
AAA32875   23 viFYNKCKHPVWPGIQPSaGQNLLAGGGFKLPANKAHSLQLPPLWS-GRFWGRHGCTFDRsGRGHCATGDCG-GsLSCNG 100 thale cress
P25871     25 FEVHNNCPYTVWAAATPV-------GGGRRLERGQSWWFWAPPGTKmARIWGRTNCNFDGaGRGWCQTGDCG-GvLECKG 96  common tobacco
CAA61411   25 FEILNQCSYTVWAAASP--------GGGRRLDAGQSWRLDVAAGTKmARIWGRTNCNFDSsGRGRCQTGDCS-GgLQCTG 95  thale cress
P13867      3 FTVVNQCPFTVWAASVPV-------GGGRQLNRGESWRITAPAGTTaARIWARTGCQFDAsGRGSCRTGDCG-GvVQCTG 74  maize
P02884     25 FEIVNRCSYTVWAAASK--GDAALDAGGRQLNSGESWTINVEPGTKgGKIWARTDCYFDDsGRGICRTGDCG-GlLQCKR 101 miracle fruit
Q41350     31 LTLVNNCPYTIWPAIQPNaGHPVLERGGFTLHSLTHRSFPAPNAHWsGRIWARTGCNYQH-GKFYCATGDCG-GrIECDG 108 tomato
1AUN_A      4 FEVHNNCPYTVWAAATPV-------GGGRRLERGQSWWFWAPPGTKmARIWGRTNCNFDGaGRGWCQTGDCG-GvLECKG 75  common tobacco
2AHN_A     82 nGAIPPATLAEFNIPA-GGGQDFYDVSLVDGFNLPMSVTPQG-GTGDCKTASCPANVNAVCPSELQKK---GSdG--SVV 154 sweet cherry
NP_177641 102 -GGVPPVTLAEFTLVG-DGGKDFYDVSLVDGYNVKLGIRPSG-GSGDCKYAGCVSDLNAACPDMLKVM---DQ-N--NVV 172 thale cress
P50694    105 nGAIPPATLAEFNIPA-GGGQDFYDVSLVDGFNLPMSVTPQG-GTGDCKTASCPANVNAVCPSELQKK---GSdG--SVV 177 sweet cherry
AAA32875  101 aGGEPPATLAEITL---GPELDFYDVSLVDGYNLAMSIMPVK-GSGQCTYAGCVSDLNQMCPVGLQVR---SR-NgkRVV 172 thale cress
P25871     97 wG-KPPNTLAEYALNQ-FSNLDFWDISVIDGFNIPMSFGPTKpGPGKCHGIQCTANINGECPGSLRVP---GG------- 164 common tobacco
CAA61411   96 wG-QPPNTLAEYALNQ-FNNLDFYDISLVDGFNIPMEFSPT---SSNCHRILCTADINGQCPNVLRAP---GG------- 160 thale cress
P13867     75 yG-RAPNTLAEYALKQ-FNNLDFFDISILDGFNVPYSFLPDG-GSGCSRGPRCAVDVNARCPAELRQD---GV------- 141 maize
P02884    102 fG-RPPTTLAEFSLNQ-Y-GKDYIDISNIKGFNVPMDFSPT---TRGCRGVRCAADIVGQCPAKLKAP---GG-G----- 166 miracle fruit
Q41350    109 lGGAAPATLAQFVLHHgHADFSTYGVSLVDGFNIPLTVTPHE-GKGVCPVVGCRANLLESCPAVLQFRshgGH-G--PVV 184 tomato
1AUN_A     76 wG-KPPNTLAEYALNQ-FSNLDFWDISVIDGFNIPMSFGPTKpGPGKCHGIQCTANINGECPGSLRVP---GG------- 143 common tobacco
2AHN_A    155 ACLSACVKFGTPQYCCTPPQNTPETCPPTNYSEIFHNACPDAYSYAYDDKRGTFTCNGg-PNYAITFCP 222 sweet cherry
NP_177641 173 ACKSACERFNTDQYCCRGANDKPETCPPTDYSRIFKNACPDAYSYAYDDETSTFTCTG--ANYEITFCP 239 thale cress
P50694    178 ACLSACVKFGTPQYCCTPPQNTPETCPPTNYSEIFHNACPDAYSYAYDDKRGTFTCNGg-PNYAITFCP 245 sweet cherry
AAA32875  173 ACKSACSAFNSPQYCCTGLFGNPQSCKPTAYSKIFKVACPKAYSYAYDEPTSIATCSK--ANYIVTFCP 239 thale cress
P25871    165 -CNNPCTTFGGQQYCCTQG-----PCGPTELSRWFKQRCPDAYSYPQDDPTSTFTCTSwtTDYKVMFCP 227 common tobacco
CAA61411  161 -CNNPCTVFQTNQYCCTNGQG---SCSDTVYSRFFKQRCPDAYSYPQDDPTSTFTCTN--TNYRVVFCP 223 thale cress
P13867    142 -CNNACPVFKKDEYCCVGSAANN--CHPTNYSRYFKGQCPDAYSYPKDDATSTFTCPAg-TNYKVVFCP 206 maize
P02884    167 -CNDACTVFQTSEYCCTTG-----KCGPTEYSRFFKRLCPDAFSYVLDKPT-TVTCPGs-SNYRVTFCP 227 miracle fruit
Q41350    185 GCKSACEAFKSDEFCCRNHYNSPQTCKPSSYSQFFKHACPATFTYAHDSPSLMHECSSp-RELKVIFCH 252 tomato
1AUN_A    144 -CNNPCTTFGGQQYCCTQG-----PCGPTELSRWFKQRCPDAYSYPQDDPTSTFTCTSwtTDYKVMFCP 206 common tobacco
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap