Conserved Protein Domain Family
IL2

?
smart00189: IL2 
Interleukin-2 family
Interleukin-2 is a cytokine produced by T-helper cells in response to antigenic or mitogenic stimulation. This protein is required for T-cell proliferation and other activities crucial to the regulation of the immune response.
Statistics
?
PSSM-Id: 128486
View PSSM: smart00189
Aligned: 4 rows
Threshold Bit Score: 175.448
Threshold Setting Gi: 290491146
Created: 13-Jul-2011
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
NP_032392      1 MYSMQLASCVTLTLVLLVNSAPTSSSTSSSTaeaqqqqqqqqqqqQHLEQLLMDLQELLSRMENYRNLKLPRMLTFKFYL 80  house mouse
NP_001036802   1 MYKIQLLSCIALTLILVTNSAPASSSTKETQ--------------QQLEQLLLDLRLLLNGVNNPENPKLSRMLTFKFYV 66  domestic cat
P19114         1 MYKIQLLSCIALTLALVANGAPTSSSTGNTM--------------KEVKSLLLDLQLLLEKVKNPENLKLSRMHTFNFYM 66  sheep
NP_001166308   1 MYKTLLLSCLALTLALLTSSAPTSSSPKQTQ--------------DRLELLLRDLQTLLEGVTS--NPRLPKMLKLKLYP 64  domestic guinea...
NP_032392     81 PKQ-ATELKDLQCLEDELGPLRHVLDLTQSKSFQLEDAENFISNIRVTVVKLKGSDNTFECQFDDESATVVDFLRRWIAF 159 house mouse
NP_001036802  67 PKK-ATELTHLQCLVEELKPLEEVLYLAQSKNFHLNHIKELMSNINVTVLKLKGSETRFTCNYDDETATIVEFLNKWITF 145 domestic cat
P19114        67 PKVnATELKHLKCLLEELKLLEEVLDLAPSKNLNTREIKDSMDNIKRIVLELQGSETRFTCEYDDATVKAVEFLNKWITF 146 sheep
NP_001166308  65 PKM-VSELQHLQCLEEELRAVEQVLNLAEHKNFPLIHTKDFISNINVTVLSLKGSETAFVCDLEDESVNIVEFLKRWTAF 143 domestic guinea...
NP_032392    160 CQSIISTSP 168 house mouse
NP_001036802 146 CQSIFSTLT 154 domestic cat
P19114       147 CQSIYSTMT 155 sheep
NP_001166308 144 CQKIMSRLT 152 domestic guinea pig
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap