1J7V


Conserved Protein Domain Family
IL10

?
smart00188: IL10 
Click on image for an interactive view with Cn3D
Interleukin-10 family
Interleukin-10 inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T cells.
Statistics
?
PSSM-Id: 128485
View PSSM: smart00188
Aligned: 23 rows
Threshold Bit Score: 235.143
Threshold Setting Gi: 82503192
Created: 13-Jul-2011
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1J7V_L        19 LPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENL 98  human
P47965        37 QTHMLRELRAAFSQVKTFFQKKDQLDNILLTDSLQQDFKGYLGCQALSEMIQFYLVEVMPQAENHGPEIKENLNSLGEKL 116 Mongolian gerbil
NP_036986     37 QTHMLRELRAAFSQVKTFFQKKDQLDNILLTDSLLQDFKGYLGCQALSEMIKFYLVEVMPQAENHGPEIKEHLNSLGEKL 116 Norway rat
NP_034678     37 QSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKL 116 house mouse
CAA43090      37 QTHMLRELRAAFSQVKTFFQKKDQLDNIVLTDSLLQDFKGYLGCQALSEMIKFYLVEVMPQAENHGPEIKEHLNSLGEKL 116 Norway rat
NP_001009327  38 LPHMLRDVRAAFGKVKTFFQMKDQLNSMLLTQSLLDDFKGYLGCQALSEMIQFYLEEVMPQAENHGPDIKEHVNSLGEKL 117 sheep
NP_999206     33 LPHMLRELRAAFGPVKSFFQTKDQMGDLLLTGSLLEDFKGYLGCQALSEMIQFYLEDVMPKAESDGEDIKEHVNSLGEKL 112 pig
DAA21479      37 LPHMLRELRAAFGEAKTFFQMKDQLHSLLLTQSLLDDFKGYLGCQALSEMIQFYLEEVMPQAENHGPDIKEHVNSLGEKL 116 cattle
P51746        38 LPLMLRELRTAFSRVKNFFQMKDQLDSMLLTQSLLDDFKGYLGCQALSEMIQFYLEEVMPQAENHGPEIKEHVNSLGEKL 117 red deer
NP_001009209  37 LPHMLXELRAAFGKVKTFFQTKDELHSILLTRSLLEDFKGYLGCQALSEMIQFYLEEVMPQAENEDPDIKQHVNSLGEKL 116 domestic cat
1J7V_L        99 KTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMT 155 human
P47965       117 KTLRMQLRRCHRFLPCENKSKAVEQVKNDFNKLQEKGVYKAMNEFDIFINCIEAYMT 173 Mongolian gerbil
NP_036986    117 KTLWIQLRRCHRFLPCENKSKAVEQVKNDFNKLQDKGVYKAMNEFDIFINCIEAYVT 173 Norway rat
NP_034678    117 KTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMM 173 house mouse
CAA43090     117 KTLWIQLRRCHRFLPCENKSKAVEQVKNDFNKLQDKGVYKAMNEFDIFINCIEAYVT 173 Norway rat
NP_001009327 118 KTLRLRLRRCHRFLPCENKSKAVEQVKRVFNMLQERGVYKAMSEFDIFINYIESYMT 174 sheep
NP_999206    113 KTLRLRLRRCHQFLPCENKSKAVEEVKSAFSKLQERGVYKAMGEFDIFINYIEAYMT 169 pig
DAA21479     117 KTLRLRLRRCHRFLPCENKSKAVEKVKRVFSELQERGVYKAMSEFDIFINYIETYMT 173 cattle
P51746       118 KTLRLRLRRCHRFLPCENKSKAVEQVKSVFSKLQERGVYKAMSEFDIFINYIETYTT 174 red deer
NP_001009209 117 KTLRLRLRRCHRFLPCENKSKVVEQVKSTFSKLQEKGVYKAMGEFDIFINYIEAYMT 173 domestic cat
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap