1MR3,2A5D


Conserved Protein Domain Family
ARF

?
smart00177: ARF 
Click on image for an interactive view with Cn3D
ARF-like small GTPases; ARF, ADP-ribosylation factor
Ras homologues involved in vesicular transport. Activator of phospholipase D isoforms. Unlike Ras proteins they lack cysteine residues at their C-termini and therefore are unlikely to be prenylated. ARFs are N-terminally myristoylated. Contains ATP/GTP-binding motif (P-loop).
Statistics
?
PSSM-Id: 128474
View PSSM: smart00177
Aligned: 4 rows
Threshold Bit Score: 374.643
Threshold Setting Gi: 27065721
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1MR3_F         5 ASKLFSNLFGNKEMRILMVGLDGAGKTTVLYKLKLGEVITTIPTIGFNVETVQYKNISFTVWDVGGQDRIRSLWRHYYRN 84  baker's yeast
NP_989018      5 FANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQN 84  western clawed ...
NP_001075174   1 MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTG 80  chicken
2A5D_A         1 MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTG 80  pig
1MR3_F        85 TEGVIFVIDSNDRSRIGEAREVMQRMLNEDELRNAVWLVFANKQDLPEAMSAAEITEKLGLHSIRNRPWFIQSTCATSGE 164 baker's yeast
NP_989018     85 TQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGD 164 western clawed ...
NP_001075174  81 TQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATTGD 160 chicken
2A5D_A        81 TQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGD 160 pig
1MR3_F       165 GLYEGLEWLSNNLKN 179 baker's yeast
NP_989018    165 GLYEGLDWLSNQLRN 179 western clawed frog
NP_001075174 161 GLYEGLTWLTSNYKS 175 chicken
2A5D_A       161 GLYEGLTWLTSNYKS 175 pig
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap