3GJ0


Conserved Protein Domain Family
RAN

?
smart00176: RAN 
Click on image for an interactive view with Cn3D
Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases
Ran is involved in the active transport of proteins through nuclear pores.
Statistics
?
PSSM-Id: 128473
View PSSM: smart00176
Aligned: 4 rows
Threshold Bit Score: 420.572
Threshold Setting Gi: 1668706
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3GJ0_A        21 VGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSR 100 human
XP_001104422  36 VGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSR 115 rhesus monkey
NP_499369     15 VGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQIRFNVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTAR 94  nematode
CAA66048      19 VGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTAR 98  thale cress
3GJ0_A       101 VTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLE 180 human
XP_001104422 116 VTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLE 195 rhesus monkey
NP_499369     95 VTYKNVPNWHRDLARVCENIPIVLCGNKVDVKDRKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLLGDPNLE 174 nematode
CAA66048      99 LTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDQNLH 178 thale cress
3GJ0_A       181 FVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDEDDD 220 human
XP_001104422 196 FVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDEDDD 235 rhesus monkey
NP_499369    175 FVAMPALAPPEVQMDPAMIAEYEKDLDNAAKAdlpddddd 214 nematode
CAA66048     179 FVESPALAPPEVHLDIAAQPKNEADLAAAAAQPLPDDDDD 218 thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap