Conserved Protein Domain Family
VPS9

?
smart00167: VPS9 
Domain present in VPS9
Domain present in yeast vacuolar sorting protein 9 and other proteins.
Statistics
?
PSSM-Id: 128469
View PSSM: smart00167
Aligned: 6 rows
Threshold Bit Score: 141.439
Threshold Setting Gi: 323346211
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAB67270   489 PVELEQVRQKLLQLVRtySPSAQVKRLLQACKLLYMALRTQE-GEGSGADGFLPLLSLVLAHCDLPELLLEAEYMSELLE 567  human
EAX10217   442 FVDVEKIKVKFMTMQKmySPEKKVMLLLRVCKLIYTVMENNS-GRMYGADDFLPVLTYVIAQCDMLELDTEIEYMMELLD 520  human
CAY81723   205 FVHLASKELGKINRFK--SPRDKMVCVLNASKVIFGLLKHTK-LEQNGADSFIPVLIYCILKGQVRYLVSNVNYIERFRS 281  Saccharomyces ce...
P97680     489 PVEIEPVRQKLLQLLRaySPSAQIKWLLQACKLLYTALKTQA-GENAGADEFLPLLSLVLAQCDLPDLLLEAEYMSELLE 567  Norway rat
EGA80501   313 FEEIKDILYEFTYHSI--SPCEKIKALLKLHEIMTYSQE-------MSNDDYLSLLIYYIITIVPRDIFLNAEFIRLFRY 383  Saccharomyces ce...
NP_508208  990 PWPSAQAELSMLDIYV--TAQDKLNCVVRCCDVINNLVALSSkNAVASADDLTPVLVFVIIKANPRALLSNVQFVETFAG 1067 nematode
AAB67270   568 PSLLTGEGGYYLTSLSASLALLSGLGQAHTLPLSPVQELR 607  human
EAX10217   521 PSLLHGEGGYYLTSAYGALSLIKNFQEEQAARLLSSETRD 560  human
CAY81723   282 PDFIRGEEEYYLSSLQAALNFIMSLTERSLTIDDHEDFEE 321  Saccharomyces cerevisiae EC1118
P97680     568 PTLLTGEGGYYLTSLSASLALLSGLSQAHALPLSPAQELQ 607  Norway rat
EGA80501   384 KKKLVETESFALTNLEAALVFVEGLTKNDfsnelqdkltv 423  Saccharomyces cerevisiae Lalvin QA23
NP_508208 1068 DRIESGRDAYYWVNFKSAVEYIKTIL-------------- 1093 nematode
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap