Conserved Protein Domain Family
SAPA

?
smart00162: SAPA 
Saposin/surfactant protein-B A-type DOMAIN
Present as four and three degenerate copies, respectively, in prosaposin and surfactant protein B. Single copies in acid sphingomyelinase, NK-lysin amoebapores and granulysin. Putative phospholipid membrane binding domains.
Statistics
?
PSSM-Id: 128465
View PSSM: smart00162
Aligned: 6 rows
Threshold Bit Score: 64.0753
Threshold Setting Gi: 165708
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O13035        22 WQKDCAKGPEVWCQSLRTASQCGAVKHCQQNVWS 55   chicken
O15997       172 GKSRCTWGPSYWCSNFSTGRECNATPHCINRVWS 205  domestic silkworm
EDL32177     474 GTEKCVWGPSYWCQNMETAARCNAVDHCKRHVWN 507  house mouse
EDL93050      14 DPKICSGGSAVVCRDVKTAVDCRAVKHCQQMVWS 47   Norway rat
XP_003312667  21 GLKECTRGSAVWCQNVKTASDCGAVKHCLQTVWN 54   chimpanzee
AAA31466      29 SPLACAQGPEFWCQSLEQALQCKALGHCLQEVWG 62   rabbit
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap