Conserved Protein Domain Family

smart00162: SAPA 
Saposin/surfactant protein-B A-type DOMAIN
Present as four and three degenerate copies, respectively, in prosaposin and surfactant protein B. Single copies in acid sphingomyelinase, NK-lysin amoebapores and granulysin. Putative phospholipid membrane binding domains.
PSSM-Id: 128465
Aligned: 6 rows
Threshold Bit Score: 64.0753
Threshold Setting Gi: 165708
Created: 12-Jul-2011
Updated: 2-Oct-2020
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
O15997       172 GKSRCTWGPSYWCSNFSTGRECNATPHCINRVWS 205  domestic silkworm
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap