1GNH,1SAC


Conserved Protein Domain Family
PTX

?
smart00159: PTX 
Click on image for an interactive view with Cn3D
Pentraxin / C-reactive protein / pentaxin family
This family form a doscoid pentameric structure. Human serum amyloid P demonstrates calcium-mediated ligand-binding.
Statistics
?
PSSM-Id: 128463
View PSSM: smart00159
Aligned: 38 rows
Threshold Bit Score: 266.055
Threshold Setting Gi: 117482
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1GNH_A         1 QTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSsT-RGYSIFSYATKRQDNEILIFWSKDIGYSFTVGG 79  human
NP_001166199 215 FKSPDAFKVSLPFRTNYLYGKIKKTLP-ELYSFTICLWLRSSAS-P-GIGTPFSYAVPGQANEIVLIEWGNNPIELLIND 291 domestic guinea...
AAA92296     183 FKSPDAFKVSLPLRTNYLYGKIKKTLP-ELYAFTICLWLRSSAS-P-GIGTPFSYAVPGQANEILLIEWGNNPIELLIND 259 human
NP_001029371 220 FKSPDAFKVSLPLRTNYLYGKIKKTLP-ELYAFTICLWLRSSAS-P-GIGTPFSYAVPGQANEIVLIEWGNNPIELLIND 296 Norway rat
NP_002513    222 NRPGDKFQLTFPLRTNYMYAKVKKSLP-EMYAFTVCMWLKSSAT-P-GVGTPFSYAVPGQANELVLIEWGNNPMEILIND 298 human
NP_714957    222 NRPGDKFQLTFPLRTNYMYAKVKKSLP-EMYAFTVCMWLKSSAA-P-GVGTPFSYAVPGQANELVLIEWGNNPMEILIND 298 Norway rat
O35764       282 YSPPDAFKVSIPIRNNYMYARVRKAVP-ELYAFTACMWLRSRSG-GsGQGTPFSYSVPGQANEIVLLEAGLEPMELLIND 359 Norway rat
P06206        27 EGEITSKVKFPPSSSPSFPRLVMVGTLPDLQEITLCYWFKVNHL-K-STLTIFSYNTAKNDNELLTSLEKQGAFHMNVHG 104 Atlantic horses...
P06207        27 EGEITSKVKFPPSSSPSFPRLVMVGTLPDLQEITLCYWFKVNCL-K-GTLHMFSYATAKKDNELLTLLDEQGDFLFNVHG 104 Atlantic horses...
AAA61234     175 LPAGCETAILFPMRSKKIFGSVHPVRPLRLESFSACIWVKATDV-L-NKTILFSYGTKRNPYEIQLYLSYQSIVFVVGGE 252 human
1GNH_A        80 S---EILFEVPEVTVAPVHICTSWESASGIVEFWVDG-KP-R--VRKSLKKGYTVGAEASIILGQEQD--SFGGNFEGSQ 150 human
NP_001166199 292 K---VAQLPLFVSDGKWHHICITWTTRDGLWEAFQDGeKL-G--TGENLAPWHPIKSGGVLILGQEQD--TVGGRFDATQ 363 domestic guinea...
AAA92296     260 K---VAQLPLFVSDGKWHHICVTWTTRDGMWEAFQDGeKL-G--TGENLAPWHPIKPGGVLILGQEQD--TVGGRFDATQ 331 human
NP_001029371 297 K---VAQLPLFVSDGKWHHICITWTTRDGMWEAFQDGeKL-G--TGENLAPWHPIKPGGVLILGQEQD--TVGGRFDATQ 368 Norway rat
NP_002513    299 K---VAKLPFVINDGKWHHICVTWTTRDGVWEAYQDG-TQgG--SGENLAPYHPIKPQGVLVLGQEQD--TLGGGFDATQ 370 human
NP_714957    299 K---VAKLPFVINDGKWHHICVTWTTRDGVWEAYQDG-TQgG--NGENLAPYHPIKPQGVLVLGQEQD--TLGGGFDATQ 370 Norway rat
O35764       360 K---VAQLPLSLKDSNWHHICIAWTTRDGLWSAYQDG-EL-Rg-SGENLAAWHPIKPHGILILGQEQD--TLGGRFDATQ 431 Norway rat
P06206       105 ApqlKVQCPNKIHIGKWHHVCHTWSSWEGEATIGVDG-FH-CkgNATGIAMGVTLSQGGLVVLGQEQD--SVGGEYDAEQ 180 Atlantic horses...
P06207       105 ApqlKVQCPNKIHIGKWHHVCHTWSSWEGEATIAVDG-FH-CkgNATGIAVGRTLSQGGLVVLGQDQD--SVGGKFDATQ 180 Atlantic horses...
AAA61234     253 En--KLVAEAMVSLGRWTHLCGTWNSEEGLTSLWVNG-EL-Aa-TTVEMATGHIVPEGGILQIGQEKNgcCVGGGFDETL 327 human
1GNH_A       151 SLVGDIGNVNMWDFVLSPDEINTIYLGGPFS-----PNVLNWRALKYEVQGEVFTKPQLWP 206 human
NP_001166199 364 AFVGELSQFNIWDRVLRPQEISNIANCSLNMa----GNIIPWVDNNVDVFGGASKWPVETC 420 domestic guinea pig
AAA92296     332 AFVGELSQFNIWDRVLRAQEIVNIANCSTNMp----GNIIPWVDNNVDVFGGASKWPVETC 388 human
NP_001029371 369 AFVGELSQFNIWDRVLRAQEIINIANCSTNMp----GNIIPWVDNNVDVFGGASKWPVETC 425 Norway rat
NP_002513    371 AFVGELAHFNIWDRKLTPGEVYNLATCSTKAl---sGNVIAWAESHIEIYGGATKWTFEAC 428 human
NP_714957    371 AFVGELAHFNIWDRKLTPGEVYNLATCSSKAl---sGNVIAWAESQIEIFGGATKWTFEAC 428 Norway rat
O35764       432 AFVGDIAQFNLWDHALTPAQVLGIANCTGPLm----GNVLPWEDKLVEAFGGAKKAAFDVC 488 Norway rat
P06206       181 SLEGELSELNLWNTVLNHEQIKHLSKCAHPSerhihGNIIQWDKTQFQAYDGVVLSPNEIC 241 Atlantic horseshoe crab
P06207       181 SLEGELSELNLWNTVLNHEQIKYLSKCAHPSerhiyGNIIQWDKTQFKAYDGVVLSPNEIC 241 Atlantic horseshoe crab
AAA61234     328 AFSGRLTGFNIWDSVLSNEEIRETGGAESCHi---rGNIVGWGVTEIQPHGGAQYVS---- 381 human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap