Conserved Protein Domain Family

smart00152: THY 
Thymosin beta actin-binding motif.
PSSM-Id: 128457
Aligned: 4 rows
Threshold Bit Score: 44.1212
Threshold Setting Gi: 195564992
Created: 12-Jul-2011
Updated: 2-Oct-2020
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
O17389        51 IHEIEHFDSTKLHSTPVKEKIVLPSADDIKQEKQHLE 87  Caenorhabditis elegans
XP_002743274  68 MAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGE 104 white-tufted-ear marmoset
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap