Conserved Protein Domain Family
SWIB

?
smart00151: SWIB 
SWI complex, BAF60b domains
Statistics
?
PSSM-Id: 128456
View PSSM: smart00151
Aligned: 11 rows
Threshold Bit Score: 80.0484
Threshold Setting Gi: 2832686
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O84466     9 FMQPVNVSADLAAIVGA--GPMPRTEIIKKMWDYIKKNGLQDPTNKRNINPDDKLAKVFGTEkPIDMFQMTKMVSQHIIK 86  Chlamydia trachomatis
Q09646   221 QPMKFKLHPRLAKVLGI--AAETRPRIIEALWQYIKTHKLQDPQDRDTINNDLFLEQCFGVS-KMRFMEIPQRLHQLLQQ 297 Caenorhabditis elegans
O76490   292 QPLQFKLDPRLARLLGV--HTQTRPVIISALWQYIKTHKLQDAHEREYINCDKYLEQIFSCQ-RMKFAEIPQRLNPLLHP 368 fruit fly
Q08747   120 STRKVTLSKSLASLLGE--HELTRTEVVRRLWAYIKAHNLQNPNNKKEILCDEKLELILGKS--TNMFEMHKILASHMTE 195 Saccharomyces cerev...
O84649   779 ATKAYTPSAALAAVIGA--DPVGRPEATKKLWEYIKEKGLQSPQNKKIIIPDSKLQGVIGAD-PIDMFALSKKLSAHLIK 855 Chlamydia trachomatis
O49641   197 LNKVCRVSPELEVVVGE--PALPRTEIVRQLWAYIRKNNLQDPSNKRKIICDDALRVVFETD-CTDMFKMNKLLAKHILP 273 thale cress
O74503   117 LNKPMKLSPKLAEFLGL--EQLSRPQTVKKLWEYIKAHDLQDPNDKRTILCDDKLKSVFEVD-TLHMFTMNKYLTNLMTK 193 Schizosaccharomyces...
O82326    65 IMKPRPVSPEMQDIVEL--PEIARTQALKRIWAYIKEHDLQDPQNKREILCDEKLKKIFEGRdRVGFLEIAKLIGPHFL- 141 thale cress
Q22749   196 MTKLCYISTELQQVTKD--QWMKRCDVVKALWDYIKENNLKDPKNGQYIICDSTLESIFKKN-RLKGFGMVKFLTRHIIG 272 Caenorhabditis elegans
CAA16786 305 ISSTVTLSEPLGKFFGTgeTEMADEEIIRRVWEYIKLNNLEVMILILKSSGFSLLLRIFFLF-AAN-------------- 369 thale cress
EGA60928 120 SVRKVLLSAPLQKFLGS--EELPRTQVVKMIWQYIKEHDLQNPKDRREILCDEKMEPIFGKK--MTMFSMNKLLTKHLFN 195 Saccharomyces cerev...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap