3OHM,2FJU,1QAS


Conserved Protein Domain Family
PLCYc

?
smart00149: PLCYc 
Click on image for an interactive view with Cn3D
Phospholipase C, catalytic domain (part); domain Y
Phosphoinositide-specific phospholipases C. These enzymes contain 2 regions (X and Y) which together form a TIM barrel-like structure containing the active site residues. Phospholipase C enzymes (PI-PLC) act as signal transducers that generate two second messengers, inositol-1,4,5-trisphosphate and diacylglycerol. The bacterial enzyme appears to be a homologue of the mammalian PLCs.
Statistics
?
PSSM-Id: 128454
View PSSM: smart00149
Aligned: 29 rows
Threshold Bit Score: 154.704
Threshold Setting Gi: 190407698
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3OHM_B       590 STLVNYIEPVKFKSFEAARKRnK-CFEMSSFVETKA-MEQLTKSPM-EFVEYNKQQLSRIYPKGTRVDSSNYMPQLFWNV 666 human
NP_001154596 317 KHLIAIHAGKPKGGITECLKVdPdKVRRLSLSEEQL-EKAAEKYAK-QIVRFTQHNLLRIYPKGTRVTSSNYNPLVGWSH 394 thale cress
CAB37509     258 RDLIAIHAANCKDPSKDCLSDdPeKPIRVSMDEQWL-DTMVRTRGT-DLVRFTQRNLVRIYPKGTRVDSSNYDPHVGWTH 335 thale cress
AAB03257     290 KRLITIHAGKPKGHVKHHLNNvG-GVKRLSLSEQEL-EKASATYGS-DIVRFTQKNIIRVYPKGTRVTSSNYRPHIGWMY 366 soybean
AAC05023     294 RDLISIHAGNRKGGLKNCLNGdPnRVIRLSMSEQWL-ETLAKTRGP-DLVKFTQRNLLRIFPKTTRFDSSNYDPLVGWIH 371 thale cress
AAB41107     286 KRLITIHAGKPKGEIQDELKAaG-NVRRLSLSEQAL-EKASESYGA-DVVRFTHNNILRVYPKGTRLNSSNYKPHIGWTY 362 cowpea
XP_629476    539 FEELIYLVSHGFKSGNTTKEI-P-SYKIHSLVEEKV-KQLVQSEPR-EVVEASQNHLLRVYPRGTRFDSSNFDPMPGWSI 614 Dictyostelium d...
NP_501213    495 SALIGLPSVKLSHNIYQDVNKhP-FDGSPSLSENKV-YTMFEAAVP--IFTYTAERLVKSYPKGLRQDSSNMHPMVSWLC 570 nematode
CAA58591     639 QQLAPYARSLKFRNFSLPESK-T-YSHIFSFSERTI-KKHGKAMVP-RLSKHNLRYLCRVYPGPLRVGSTNFNPQVYWRL 714 fission yeast
EDV10963     587 VSNISGIHGIKFRNFSLPESK-T-IAHCFSLNERKVeYMIKDKHLKlSLDKHNRRYLMRVYPHVLRYKSSNFNPIPFWKA 664 Saccharomyces c...
3OHM_B       667 GCQLVALNFQTLDVAMQLNAGVFEYNGR-------SGYLLKPEFM 704 human
NP_001154596 395 GAQMVAFNMQGYGRSLWLMQGMFRANGG-------CGYIKKPDLL 432 thale cress
CAB37509     336 GAQMVAFNMQGHGKQLWIMQGMFRGNGG-------CGYVKKPRIL 373 thale cress
AAB03257     367 GAQMVAFNMQGHGKSLWYMQGMFRANGG-------CGYVKKPAFL 404 soybean
AAC05023     372 GAQMVAFNMQSHGRYLWMMQGMFKANGG-------CGYVKKPDVL 409 thale cress
AAB41107     363 GAQMVAFNMQGHGKSLWYMQGMFRSNGG-------CGYVKKPNFL 400 cowpea
XP_629476    615 GCQLAALNQQTSSEPMWINDGMFSDNGG-------CGYVLKPPCL 652 Dictyostelium discoideum AX4
NP_501213    571 GIQSVAMNFQTAGEELDLNAGLFRINGN-------CGYVLKPSCL 608 nematode
CAA58591     715 GVQMVALNWQTYDTGLQINDALFIADPP-------TGYLLKPPCQ 752 fission yeast
EDV10963     665 GVQMVATNWQTNDIGQQLNLAMFQILDHqpdgsfkSGYVLKPKKL 709 Saccharomyces cerevisiae RM11-1a
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap