3DI2


Conserved Protein Domain Family
IL7

?
smart00127: IL7 
Click on image for an interactive view with Cn3D
Interleukin-7 and interleukin-9 family.
IL-7 is a cytokine that acts as a growth factor for early lymphoid cells of both B- and T-cell lineages. IL-9 is a multifunctional cytokine that, although originally described as a T-cell growth factor, its function in T-cell response remains unclear.
Statistics
?
PSSM-Id: 128432
View PSSM: smart00127
Aligned: 6 rows
Threshold Bit Score: 234.562
Threshold Setting Gi: 3024010
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3DI2_A         4 CDIEGKDGKQYESVLMVSIDQLlDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLK 83  human
NP_001009777  27 CDFSGKDGGAYQNVLMVSIDDL-DNMINFDSNCLNNEPNFFKKHSCDDNKEASFLNRAARKLKQFLKMNISDDFKLHLST 105 sheep
P26895        27 CDISGKDGGAYQNVLMVNIDDL-DNMINFDSNCLNNEPNFFKKHSCDDNKEASFLNRASRKLRQFLKMNISDDFKLHLST 105 cattle
NP_032397     27 CHIKDKEGKAYESVLMISIDEL-DKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLT 105 house mouse
P56478        27 CHIKDKDGKAFGSVLMISINQL-DKMTGTDSDCPNNEPNFFKKHLCDDTKEAAFLNRAARKLRQFLKMNISEEFNDHLLR 105 Norway rat
AAX36840      27 CDIEGKDGKQYESVLMVSIDQLlDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLK 106 synthetic const...
3DI2_A        84 VSEGTTILLNCTGQVKGRKPAALGAAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMG 150 human
NP_001009777 106 VSQGTLTLLNCTSKGKGRKPPSLGEAQPTKNLEENKSLKEQRKQNDLCFLKILLQKIKTCWNKILRG 172 sheep
P26895       106 VSQGTLTLLNCTSKGKGRKPPSLSEAQPTKNLEENKSSKEQKKQNDLCFLKILLQKIKTCWNKILRG 172 cattle
NP_032397    106 VSQGTQTLVNCTSK-------------------EEKNVKEQKK-NDACFLKRLLREIKTCWNKILKG 152 house mouse
P56478       106 VSDGTQTLVNCTSK-------------------EEKTIKEQKK-NDPCFLKRLLREIKTCWNKILKG 152 Norway rat
AAX36840     107 VSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMG 173 synthetic construct
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap