1I1R,1BGC


Conserved Protein Domain Family
IL6

?
smart00126: IL6 
Click on image for an interactive view with Cn3D
Interleukin-6 homologues
Family includes granulocyte colony-stimulating factor (G-CSF) and myelomonocytic growth factor (MGF). IL-6 is also known as B-cell stimulatory factor 2.
Statistics
?
PSSM-Id: 128431
View PSSM: smart00126
Aligned: 9 rows
Threshold Bit Score: 172.964
Threshold Setting Gi: 157830293
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1I1R_B        16 LNWMLWVIDECFRDLCYRTGICKGILEPAAIFHLKLPAINDTDHCGLIGFNETSCLKKLADGFFEFEVLFKFLTTEFGK- 94  KSHV
NP_001036198  57 IRYILDGISALRKETCNRSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEDTCLVKIITGLLEFEVYLEYLQNRFES- 135 rhesus monkey
NP_001075965  54 IKYILGKISALKNEMCNNFSKCENSKEVLAENNLNLPKMAEKDGCFQSGFNQETCLMKITTGLSEFQIYLEYLQNEFKG- 132 horse
AAT01105     167 ITHVLWEIVEMRKELCNGNSDCMNNDDALAENNLKLPEIQRNDGCYQTGYNQEICLLKISSGLLEYHSYLEYMKNNLKD- 245 rpL23-fusion ex...
O35736        50 ISYLIKEVFEMRKELCKNDETCIKSHVAVSENNLNLPKMTEKDGCFQTGYNRDDCLVRITSGLLEFQVYLRYIRNKFQEg 129 woodchuck
Q98823        39 LNWMLWVIDECFRDLCYRTGICKGILEPAAIFHLKLPAINDTDHCGLIGFNETSCLKKLADGFFEFEVLFKFLTTEFGK- 117 Human herpesvir...
Q28319        57 IKHIVDKISAIRKEICEKNDECENSKETLAENKLKLPKMEEKDGCFQSGFNQAICLIKTTAGLLEYQIYLDFLQNEFEG- 135 goat
NP_990610     46 TRKIRGDVAALQRAVCDTFQLCTEEELQLVQPDPHLVQA-PLDQCHKRGFQAEVCFTQIRAGLHAYHDSLGAVLRLLPN- 123 chicken
1BGC_A        21 VRKIQADGAELQERLCAAHKLCHPEELMLLRHSLGIPQA-PLSSCSSQSLQLRGCLNQLHGGLFLYQGLLQALAGISPE- 98  cattle
1I1R_B        95 -S-VINVDVMELLTKTLGWDIQEELNKLTKTHYSPPKFDRGLLGRLQGLKYWVRHFASFYVLSAMEKFAGQAVRVLD 169 KSHV
NP_001036198 136 -S-EEQARAVQMSTKVLIQFLQKKAKNLDAITTPEPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSNLRALR 210 rhesus monkey
NP_001075965 133 -E-KENIKTMQISTKVLVQILMQKMKNPE-VTTPDPTAKSSLLAKLHSQNEWLKNTTTHLILRSLEDFLQFSLRAVR 206 horse
AAT01105     246 -NkKDKARVLQRDTETLIHIFNQEVKDLHKIVLPTPISNALLTDKLESQKEWLRTKTIQFILKSLEEFLKVTLRSTR 321 rpL23-fusion expre...
O35736       130 nN-RDRAEHVQSSSKALIEILKQEVKDPNKIVFPSPTANINLLAKLESQNDWQKVMTMQLILSNFEDFLQFTLRAVR 205 woodchuck
Q98823       118 -S-VINVDVMELLTKTLGWDIQEELNKLTKTHYSPPKFDRGLLGRLQGLKYWVRHFASFYVLSAMEKFAGQAVRVLD 192 Human herpesvirus 8
Q28319       136 -N-QETVMELQSSIRTLIQILKEKIAGLI----TTPATNTDMLEKMQSSNEWVKNAKVIIILRSLENFLQFSLRAIR 206 goat
NP_990610    124 -H-TTLVETLQLDAANLSSNIQQQMEDLGLDTVTLPAEQRSPPPTFSGPFQ--QQVGGFFILANFQRFLETAYRALR 196 chicken
1BGC_A        99 -L-APTLDTLQLDVTDFATNIWLQMEDLG--AAPAVQPTQGAMPTFTSAFQ--RRAGGVLVASQLHRFLELAYRGLR 169 cattle
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap