1B55,2YS2


Conserved Protein Domain Family
BTK

?
smart00107: BTK 
Click on image for an interactive view with Cn3D
Bruton's tyrosine kinase Cys-rich motif
Zinc-binding motif containing conserved cysteines and a histidine. Always found C-terminal to PH domains (but not all PH domains are followed by BTK motifs). The crystal structure shows this motif packs against the PH domain. The PH+Btk module pair has been called the Tec homology (TH) region.
Statistics
?
PSSM-Id: 128417
View PSSM: smart00107
Aligned: 11 rows
Threshold Bit Score: 59.3173
Threshold Setting Gi: 159164805
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1B55_A        134 NSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILEN 169  human
AAC60250      109 NTELLQKYHPCFWMEGEWSCCQQSAKTAPGCCLVHT 144  clearnose skate
XP_861721     135 NSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILEN 170  dog
XP_002806710  113 NNNIMIKYHPKFWTDGSYQCCRQTEKLAPGCEKYNL 148  white-tufted-ear marmoset
NP_571179     112 NNSLFLKYHPDFWGEGKWRCCQQTEKLATGCSEYYP 147  zebrafish
NP_001099194  706 NHNRLSSFHPSAYLNGNWLCCQETSEGTPGCKPCTA 741  Norway rat
XP_002831455  117 NPHLLVKYHSGFFVDGKFLCCQQSCKAAPGCTLWEA 152  Sumatran orangutan
NP_033051     679 NQKRLTVFHPSAYLNGHWLCCRASSDTAAGCTPCTG 714  house mouse
XP_002094256  862 NSIRMQYFHPSAFVSGFYSCCGRSDENSPGCKKVLD 897  Drosophila yakuba
Q03526        119 NNSLVSKYHPNFWMDGRWRCCSQLEKPAVGCAPYDP 154  house mouse
2YS2_A          8 NPHLLVKYHSGFFVDGKFLCCQQSCKAAPGCTLWEA 43   human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap