1O9C


Conserved Protein Domain Family
14_3_3

?
smart00101: 14_3_3 
Click on image for an interactive view with Cn3D
14-3-3 homologues
14-3-3 homologues mediates signal transduction by binding to phosphoserine-containing proteins. They are involved in growth factor signalling and also interact with MEK kinases.
Statistics
?
PSSM-Id: 128412
View PSSM: smart00101
Aligned: 7 rows
Threshold Bit Score: 399.675
Threshold Setting Gi: 3023191
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1O9C_A      8 REENVYMAKLAEQAERYEEMVEFMEKVSNSLG-----SEELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEESRGNE 82  common tobacco
P46266      8 REENVYMAKLAEQAERYEEMVEFMEKVSANAD-----SEELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEESRGNE 82  pea
CAA44259    8 REENVYMAKLAEQAERYEEMVEFMEKVAKTAD-----VGELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEESRGNE 82  domesticated barley
Q01526      8 REENVYMAKLAEQAERYEEMVEFMEKVAKTVD-----SEELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEEGRGNE 82  maize
Q41418      5 REENVYMAKLAEQAERYEEMVEFMEKVAK-VD-----VEELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEESRGNE 78  potato
NP_568325   7 REENVYLAKLAEQAERYEEMVEFMEKVAKTVE-----TEELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEDSRGNS 81  thale cress
Q25538      9 RDEYVYKAKLAEQAERYDEMAEAMKNLVENCLdeqqpKDELSVEERNLLSVAYKNAVGARRASWRIISSVEQKELSKQHM 88  Neospora caninum
1O9C_A     83 EHVNSIREYRSKIENELSKICDGILKLLDAKLIPSAASGDSKVFYLKMKGDYHRYLAEFKTGA-ERKEAAESTLTAYKAA 161 common tobacco
P46266     83 DHVAVIRDYRSKIESELSNICDGILKLLDTRLIPSASSGDSKVFYLKMKGDYHRYLAEFKTGA-ERKEAAESTLTGYKSA 161 pea
CAA44259   83 AYVASIKEYRTRIETELSKICDGILKLLDSHLVPSATAAESKVFYLKMKGDYHRYLAEFKAGA-ERKEAAENTLVAYKSA 161 domesticated barley
Q01526     83 DRVTLIKDYRGKIETELTKICDGILKLLESHLVPSSTAPESKVFYLKMKGDYYRYLAEFKTGA-ERKDAAENTMVAYKAA 161 maize
Q41418     79 DHVSSIKEYRVKIEAELSKICDGILSLLESHLVPSASTAESKVFYLKMKGDYHRYLAEFKTGArERKEAAENTLLAYKSA 158 potato
NP_568325  82 DHVSIIKDYRGKIETELSKICDGILNLLEAHLIPAASLAESKVFYLKMKGDYHRYLAEFKTGA-ERKEAAESTLVAYKSA 160 thale cress
Q25538     89 QNKALAAEYRQKVEEELNKICHDILQLLTDKLIPKTSDSESKVFYYKMKGDYYRYISEFSGEE-GKKQAADQAQESYQKA 167 Neospora caninum
1O9C_A    162 QDIATTELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDM 241 common tobacco
P46266    162 QDIANAELPPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDM 241 pea
CAA44259  162 QDIALADLPTTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDSLGEESYKDSTLIMQLLRDNLTLWTSDN 241 domesticated barley
Q01526    162 QDIALAELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAISELDTLSEESYKDSTLIMQLLHDNLTLWTSDI 241 maize
Q41418    159 QDIALAELTPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDDAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDT 238 potato
NP_568325 161 QDIALADLAPTHPIRLGLALNFSVFYYEILNSSDRACSLAKQAFDEAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDL 240 thale cress
Q25538    168 TETAEGHSPATHPIRLGLALNYSVFFYEILNLPQQACEMAKRAFDDAITEFDNVSEDSYKDSTLIMQLLRDNLTLWTSDL 247 Neospora caninum
1O9C_A    242 QDDGADEIKE 251 common tobacco
P46266    242 QDDGADEIKE 251 pea
CAA44259  242 AEEGGDEIKE 251 domesticated barley
Q01526    242 SEDPAEEIRE 251 maize
Q41418    239 TDDAEDEIRE 248 potato
NP_568325 241 NDEAGDDIKE 250 thale cress
Q25538    248 QADQQQQEGG 257 Neospora caninum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap