2Z15


Conserved Protein Domain Family
btg1

?
smart00099: btg1 
Click on image for an interactive view with Cn3D
tob/btg1 family
The tob/btg1 is a family of proteins that inhibit cell proliferation.
Statistics
?
PSSM-Id: 128410
View PSSM: smart00099
Aligned: 5 rows
Threshold Bit Score: 191.19
Threshold Setting Gi: 147902557
Created: 13-Jul-2011
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2Z15_A         8 MQLEIQVALNFIISYL--YNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHIG--EKVDPVIEQASKESG 83  human
XP_002752860 100 MIGEIAAAVSFISKFLrtKGLTSERQLQTFSQSLQELLAEHYKHHWFPEKPCKGSGYRCIRIN--HKMDPLIGQAAQRIG 177 white-tufted-ea...
AAX37060       1 MQLEIQVALNFIISYL--YNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHIG--EKVDPVIEQASKESG 76  synthetic const...
EDM10603       8 MKNEIAAVVFFFTRLVrkHDKLKKEAVERFAEKLTQILQEKYKNHWYPEKPSKGQAYRCIRVNkfQRVDPDVLKACENSC 87  Norway rat
NP_001081023   1 MKEEIAATVVFLTMLVkkHKQLSKQKIEKFAAKLTTILFAKYKNHWYAENPMKGQAFRCIRINtyQAIDAVFEKACAESN 80  African clawed ...
2Z15_A        84 LDIDDVRgnLPQDLSVWIDPFEVSYQIGEK 113 human
XP_002752860 178 LSSQELFrlLPSELTLWVDPYEVSYRIGED 207 white-tufted-ear marmoset
AAX37060      77 LDIDDVRgnLPQDLSVWIDPFEVSYQIGEK 106 synthetic construct
EDM10603      88 ILYSDLG--LPKELTLWVDPCEVCCRYGEK 115 Norway rat
NP_001081023  81 VDFNDLG--LPKEMTIWVDPFEVCCRYGEK 108 African clawed frog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap