2UTG,1CCD,1PUO


Conserved Protein Domain Family
UTG

?
smart00096: UTG 
Click on image for an interactive view with Cn3D
Uteroglobin
Statistics
?
PSSM-Id: 128407
View PSSM: smart00096
Aligned: 8 rows
Threshold Bit Score: 108.379
Threshold Setting Gi: 1169665
Created: 13-Jul-2011
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2UTG_A      1 GICPRFAHVIENLLLGTPSSYETSLKEFEPDDTMKDAGMQMKKVLDS-LPQTTRENIMKLTEKIVKSPLC 69  rabbit
P06913     22 GICPGFAHVIENLLLGTPSSYETSLKEFQPDDAMKDAGMQMKKVLDT-LPQTTRENIIKLTEKIVKSPLC 90  brown hare
P30438     23 EICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILKNCVDAkMTEEDKENALSVLDKIYTSPLC 92  domestic cat
NP_035811  22 DICPGFLQVLEALLMESESGYVASLKPFNPGSDLQNAGTQLKRLVDT-LPQETRINIMKLTEKILTSPLC 90  house mouse
1CCD_A      3 DICPGFLQVLEALLLGSESNYEAALKPFNPASDLQNAGTQLKRLVDT-LPQETRINIVKLTEKILTSPLC 71  black rat
NP_003348  22 EICPSFQRVIETLLMDTPSSYEAAMELFSPDQDMREAGAQLKKLVDT-LPQKPRESIIKLMEKIAQSSLC 90  human
AAC37318   23 EICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILKNCVDAkMTEEDKENALSLLDKIYTSPLC 92  domestic cat
1PUO_A     93 EICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILKNCVDAkMTEEDKENALSLLDKIYTSPLC 162 domestic cat
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap