1ZCR


Conserved Protein Domain Family
TR_THY

?
smart00095: TR_THY 
Click on image for an interactive view with Cn3D
Transthyretin
Statistics
?
PSSM-Id: 128406
View PSSM: smart00095
Aligned: 13 rows
Threshold Bit Score: 238.244
Threshold Setting Gi: 136466
Created: 13-Jul-2011
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1ZCR_A         8 ESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISP 87
gi 333033763  27 ESKCPLMVKVLDAVRGSPAVDVAVKVFKKTADGSWEPFASGKTAESGELHGLTTDEKFTEGVYRVELDTKSYWKALGISP 106
gi 7305599    27 ESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISP 106
gi 47523508   27 ESKCPLMVKVLDAVRGSPAVNVGVKVFKKAADGTWEPFALGKTSEFGELHGLTTDEKFVEGIYKVELDTKSYWKALGISP 106
gi 74136489   29 DSKCPLMVKVLDAVRGSPAVNVNVKVFKKSEEQTWEPFATGKTNDYGEIHELTNDEKFGEGLYKVEFDTFSYWNALGVSP 108
gi 1174820    29 HSKCPLMVKVLDAVRGRPAVNVDVKVFKKTEEQTWELFAAGKTNDNGEIHELTTDDKFGEGLYKVEFDTISYWKALGVSP 108
gi 1351320    29 DSKCPLMVKVLDAVRGRPAVNVDVKVFKKTEKQTWELFASGKTNDNGEIHELTSDDKFGEGLYKVEFDTISYWKALGVSP 108
gi 1351321    29 DSKCPLMVKVLDSVRGSPAVNVDVKVFKKTEEQTWELFASGKTNNNGEIHELTSDDQFGEGLYKVEFDTVSYWKTFGISP 108
gi 2501406    29 HSKCPLMVKVLDAVRGRPAVNVDVKVFKKTEEQTWELFAAGKTNDNGEIHELTTDDKFGEGLYKVEFDTISYWKALGVSP 108
gi 267178     30 DSKCPLMVKVLDAVRGRPATSIAVKVSKMSEEGDWKEFANGKTNEFGEIHELTTDEQFVQGLYKVEFDTSSYWKALGVSP 109
gi 45384444   30 DSKCPLMVKVLDAVRGSPAANVAVKVFKKAADGTWQDFATGKTTEFGEIHELTTEEQFVEGVYRVEFDTSSYWKGLGLSP 109
gi 57526651   27 ESKCPLMVKVLDAVRGSPAANVGVKVFKKAADETWEPFASGKTSDSGELHGLTTEDKFVEGLYKVELDTKSYWKSLGISP 106
gi 136466      7 DSKCPLMVKVLDAVRGSPAVDVSVHVFKKAADETWEPFASGKTSKTGELHGLTTSEKFVEGVYKVELDTKSYWKALGISP 86
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|.
1ZCR_A        88 FHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKE 128
gi 333033763 107 FHEYAEVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN 147
gi 7305599   107 FHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN 147
gi 47523508  107 FHEYAEVVFTANDSGRRHYTIAALLSPYSYSTTALVSSPKE 147
gi 74136489  109 FHEYADVVFKANDAGHRHYTIAALLSPYSYSTTAVVSNPKD 149
gi 1174820   109 FHEYADVVFTANDAGHRHYTIAALLSPYSFSTTAIVSNPTE 149
gi 1351320   109 FHEYADVVFTANDAGHRHYTIAAQLSPYSFSTTAIVSNPTE 149
gi 1351321   109 FHEYADVVFTANDAGHRHYTIAAQLSPFSFSTTAVVSNPKD 149
gi 2501406   109 FHEYADVVFTANDAGHRHYTIAAQLSPYSFSTTAIVSNPTE 149
gi 267178    110 FHEYADVVFSANDSGHRHYTIAALLSPFSYSTTAVVSDPKE 150
gi 45384444  110 FHEYADVVFTANDSGHRHYTIAALLSPFSYSTTAVVSDPQE 150
gi 57526651  107 FHEYAEVVFTANDSGLRHYTIAALLSPYSYSTTALVSSPKE 147
gi 136466     87 FHEYAEVVFTANDSGHRSYTIAALLSPFSYSTTAVVSNPQE 127
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap