Conserved Protein Domain Family

smart00095: TR_THY 
Click on image for an interactive view with Cn3D
PSSM-Id: 128406
View PSSM: smart00095
Aligned: 13 rows
Threshold Bit Score: 238.244
Threshold Setting Gi: 136466
Created: 13-Jul-2011
Updated: 2-Oct-2020
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
NP_001028140 109 FHEYADVVFKANDAGHRHYTIAALLSPYSYSTTAVVSNPKD 149 gray short-tailed opossum
Q29616       109 FHEYADVVFTANDAGHRHYTIAAQLSPYSFSTTAIVSNPTE 149 eastern gray kangaroo
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap