1ZCR


Conserved Protein Domain Family
TR_THY

?
smart00095: TR_THY 
Click on image for an interactive view with Cn3D
Transthyretin
Statistics
?
Aligned: 13 rows
Threshold Bit Score: 238.244
Threshold Setting Gi: 136466
Created: 13-Jul-2011
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1ZCR_A         8 ESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISP 87  human
NP_036813     27 ESKCPLMVKVLDAVRGSPAVDVAVKVFKKTADGSWEPFASGKTAESGELHGLTTDEKFTEGVYRVELDTKSYWKALGISP 106 Norway rat
NP_038725     27 ESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISP 106 house mouse
NP_999377     27 ESKCPLMVKVLDAVRGSPAVNVGVKVFKKAADGTWEPFALGKTSEFGELHGLTTDEKFVEGIYKVELDTKSYWKALGISP 106 pig
NP_001028140  29 DSKCPLMVKVLDAVRGSPAVNVNVKVFKKSEEQTWEPFATGKTNDYGEIHELTNDEKFGEGLYKVEFDTFSYWNALGVSP 108 gray short-tail...
P42204        29 HSKCPLMVKVLDAVRGRPAVNVDVKVFKKTEEQTWELFAAGKTNDNGEIHELTTDDKFGEGLYKVEFDTISYWKALGVSP 108 tammar wallaby
P49142        29 DSKCPLMVKVLDAVRGRPAVNVDVKVFKKTEKQTWELFASGKTNDNGEIHELTSDDKFGEGLYKVEFDTISYWKALGVSP 108 sugar glider
P49143        29 DSKCPLMVKVLDSVRGSPAVNVDVKVFKKTEEQTWELFASGKTNNNGEIHELTSDDQFGEGLYKVEFDTVSYWKTFGISP 108 stripe-faced du...
Q29616        29 HSKCPLMVKVLDAVRGRPAVNVDVKVFKKTEEQTWELFAAGKTNDNGEIHELTTDDKFGEGLYKVEFDTISYWKALGVSP 108 eastern gray ka...
P30623        30 DSKCPLMVKVLDAVRGRPATSIAVKVSKMSEEGDWKEFANGKTNEFGEIHELTTDEQFVQGLYKVEFDTSSYWKALGVSP 109 stump-tailed skink
NP_990666     30 DSKCPLMVKVLDAVRGSPAANVAVKVFKKAADGTWQDFATGKTTEFGEIHELTTEEQFVEGVYRVEFDTSSYWKGLGLSP 109 chicken
NP_001009800  27 ESKCPLMVKVLDAVRGSPAANVGVKVFKKAADETWEPFASGKTSDSGELHGLTTEDKFVEGLYKVELDTKSYWKSLGISP 106 sheep
P07489         7 DSKCPLMVKVLDAVRGSPAVDVSVHVFKKAADETWEPFASGKTSKTGELHGLTTSEKFVEGVYKVELDTKSYWKALGISP 86  rabbit
1ZCR_A        88 FHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKE 128 human
NP_036813    107 FHEYAEVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN 147 Norway rat
NP_038725    107 FHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN 147 house mouse
NP_999377    107 FHEYAEVVFTANDSGRRHYTIAALLSPYSYSTTALVSSPKE 147 pig
NP_001028140 109 FHEYADVVFKANDAGHRHYTIAALLSPYSYSTTAVVSNPKD 149 gray short-tailed opossum
P42204       109 FHEYADVVFTANDAGHRHYTIAALLSPYSFSTTAIVSNPTE 149 tammar wallaby
P49142       109 FHEYADVVFTANDAGHRHYTIAAQLSPYSFSTTAIVSNPTE 149 sugar glider
P49143       109 FHEYADVVFTANDAGHRHYTIAAQLSPFSFSTTAVVSNPKD 149 stripe-faced dunnart
Q29616       109 FHEYADVVFTANDAGHRHYTIAAQLSPYSFSTTAIVSNPTE 149 eastern gray kangaroo
P30623       110 FHEYADVVFSANDSGHRHYTIAALLSPFSYSTTAVVSDPKE 150 stump-tailed skink
NP_990666    110 FHEYADVVFTANDSGHRHYTIAALLSPFSYSTTAVVSDPQE 150 chicken
NP_001009800 107 FHEYAEVVFTANDSGLRHYTIAALLSPYSYSTTALVSSPKE 147 sheep
P07489        87 FHEYAEVVFTANDSGHRSYTIAALLSPFSYSTTAVVSNPQE 127 rabbit
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap