1Z7X,2BWK,1K5B,1AGI,1HI2,1QMT,1PU3


Conserved Protein Domain Family
RNAse_Pc

?
smart00092: RNAse_Pc 
Click on image for an interactive view with Cn3D
Pancreatic ribonuclease
Statistics
?
PSSM-Id: 128403
View PSSM: smart00092
Aligned: 90 rows
Threshold Bit Score: 93.5122
Threshold Setting Gi: 47168565
Created: 13-Jul-2011
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1Z7X_X         2 KESRAKKFQRQHMdsdss-pssssT--YCNQMMRRRNMT-Q-G-RCKPVNTFVHEPLVDVQNVCFQEKVTcKNGQG---N 72  human
NP_001116866  26 DNYRYIKFLTQHYdakpt--grdyR--YCESMMKKRKLT-S-P--CKEVNTFIHDTKNNIKAICG------ENGRPygvN 91  house mouse
NP_001092866  25 QNDAYRGFLRKHYdpspt--ghddR--YCNTMMERRNMT-R-P--CKDTNTFIHGNSDDIRAVCDDRNG--EPYRN---G 91  cattle
P04061         1 -ETRYEKFLRQHVdypkssapdsrT--YCNQMMQRRGMT-S-P-VCKFTNTFVHASAASITTVCGSGGTP---ASG---D 68  snapping turtle
AAV41029      24 kgQNWSSFQNKHIdypet--sasnPnaYCDLMMQRRNLN-P-T-KCKTRNTFVHASPSEIQQVCGSGG---THYED---N 92  common iguana
NP_001007943  23 GVPTYQDFLYKHMdfpkt--sfpsNaaYCNVMMVRRGMTaH-G-RCKSFNTFVHTDPRNLNTLCINQPDQ---------A 89  chicken
NP_990590     23 GVPTYQDFLRTHVdfpkt--sfpnIaaYCNVMMVRRGIN-VhG-RCKSLNTFVHTDPRNLNTLCINQP------NR---A 89  chicken
AAG30414      20 lsQNWAKFKEKHItst------ssI--DCNTIMDKAIYI-V-GgKCKERNTFIISSEDNVKAICSGVS------PD---R 80  bullfrog
P11916        21 lsQNWATFQQKHIint------piI--NCNTIMDNNIYI-V-GgQCKRVNTFIISSATTVKAICTGVI-------N---M 80  bullfrog
P18839         1 --QNWAKFQEKHIpnt------snI--NCNTIMDKSIYI-V-GgQCKERNTFIISSATTVKAICSGAS------TN---R 59  Japanese frog
1Z7X_X        73 CYKSNSSMHITDCRLTNGSRYPNCAYRTSPKERHIIVACEGSPyVPVHFDASV 125 human
NP_001116866  92 FRISNSRFQVTTCTHKGGSPRPPCQYNAFKDFRYIVIACEDG--WPVHFDESF 142 house mouse
NP_001092866  92 LRRSRSPFQVTTCRHRGGSPRPPCRYRAFRANRVIVIRCRDG--FPIHLEENF 142 cattle
P04061        69 LRDSNASFALTTCRLQGGSQTPNCPYNADASTQRIRIACVGG--LPVHYDKSI 119 snapping turtle
AAV41029      93 LYDSNESFDLTDCKNVGGTAPSSCKYNGTPGTKRIRIACENNQ--PVHFElvl 143 common iguana
NP_001007943  90 LRTTRRHFRITDCKLIRS--HPTCRYSGNQFNRRVRVGCRGG--LPVHLDGTs 138 chicken
NP_990590     90 LRTTQQQLPVTDCKLIRS--HPTCSYTGNQFNHRVRVGCWGG--LPVHLDGTF 138 chicken
AAG30414      81 KELSTTSFKLNTCIRD-SITPRPCPYHPSPDNNKICVKCEKQ--LPVHFVGIG 130 bullfrog
P11916        81 NVLSTTRFQLNTCTRT-SITPRPCPYSSRTETNYICVKCENQ--YPVHFAGIG 130 bullfrog
P18839        60 NVLSTTRFQLNTCIRSA-TAPRPCPYNSRTETNVICVKCENR--LPVHFAGIG 109 Japanese frog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap