Conserved Protein Domain Family
Galanin

?
smart00071: Galanin 
Galanin
Galanin is a neuropeptide that controls various biological activities: it regulates the release growth hormone, inhibits the release of insulin and somatostatin, contracts smooth muscle of the gastrointestinal and genitourinary tract and may be involved in the control of adrenal secretion
Statistics
?
PSSM-Id: 128385
View PSSM: smart00071
Aligned: 5 rows
Threshold Bit Score: 181.228
Threshold Setting Gi: 73983582
Created: 13-Jul-2011
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
NP_034383  21 TLGLGMPAKEKRGWTLNSAGYLLGPHAIDNHRSFSDKHGLTGKRELQLEVeERRPGSVDVPLPESNI--VRTIMEFLSFL 98  house mouse
NP_999399  21 TLGLGSPVKEKRGWTLNSAGYLLGPHAIDNHRSFHDKYGLAGKRELEPED-EARPGGFDRLQSEDKA--IRTIMEFLAFL 97  pig
AAA60178    5 SAGLWSPAKEKRGWTLNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPED-DMKPGSFDRSIPENNI--MRTIIEFLSFL 81  human
NP_776339  21 tlglGSPVKEKRGWTLNSAGYLLGPHALDSHRSFQDKHGLAGKRELEPED-EARPGSFDRPLAENNV--VRTIIEFLTFL 97  cattle
XP_854576 126 mtllpfeVKEKRGWTLNSAGYLLGPHAIDNHRSFHEKPGLTGKRELPPED-EGRSGGFAGPLSLSENaaVRMLIEFLTFL 204 dog
NP_034383  99 HLKEAGALDSLPGIPLATSSEDLEKS 124 house mouse
NP_999399  98 HLKEAGALGRLPGLPSAASSEDAGQS 123 pig
AAA60178   82 HLKEAGALDRLLDLPAAASSEDIERS 107 human
NP_776339  98 HLKDAGALERLPSLPTAESAEDAERS 123 cattle
XP_854576 205 RLKEAGALPDLPDLPSAVSAEDMEQp 230 dog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap