1HCN


Conserved Protein Domain Family
GHA

?
smart00067: GHA 
Click on image for an interactive view with Cn3D
Glycoprotein hormone alpha chain homologues.
Also called gonadotropins. Glycoprotein hormones consist of two glycosylated chains (alpha and beta) of similar topology.
Statistics
?
PSSM-Id: 128381
View PSSM: smart00067
Aligned: 10 rows
Threshold Bit Score: 133.02
Threshold Setting Gi: 1346138
Created: 13-Jul-2011
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1HCN_A         6 DCPECTLQENPFFSQPGA-PILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHC 84  human
NP_776326     34 GCPECKLKENKYFSKPDA-PIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNVRVENHTECHC 112 cattle
NP_000726     30 DCPECTLQENPFFSQPGA-PILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHC 108 human
P18857        33 GCEECKLKENNIFSKPGA-PVYQCMGCCFSRAYPTPLRSKKTMLVPKNITSEATCCVAKEFKQV-LVNDIKLVNHTDCHC 110 common carp
NP_001093233  34 DCPECKLRENKYFFKLGV-PIYQCKGCCFSRAYPTPARSRKTMLVPKNITSESTCCVAKAFIRVTVMGNIKLENHTQCYC 112 horse
P27794        34 GCDECRLQENKIFSKPSA-PIFQCVGCCFSRAYPTPLRSKKTMLVPKNITSEATCCVAREVTR---LDNMKLENHTDCHC 109 European eel
AAO72302      29 GCEECTLKPNTIFPN-----IMQCTGCCFSRAYPTPLRSKQTMLVPKNITSEATCCVAKEGERVTTKDGFPVTNHTECHC 103 coho salmon
P30970        33 GCEACTLRKNTVFSRDR--PIYQCMGCCFSRAYPTPLKAMKTMTIPKNITSEATCCVAKHVYE-TEVAGIRVRNHTDCHC 109 yellowfin seabream
P47744        40 ACGECSLGLNRLFSRDR--PLYQCMGCCFSRAYPTPQTAIQTMAIPKNITSEAKCCVAKHSYE-TKVDDITVRNHTECHC 116 killifish
P80051        10 GCPECRLKENLRFSNMGIgRIYQCSGCCYSRAYPTPMRSKKTMLVPKNITSEAKCCVAKTQYRVTVMDNVKIENHTACHC 89  bullfrog
1HCN_A        85 STCYYHKS 92  human
NP_776326    113 STCYYHKS 120 cattle
NP_000726    109 STCYYHKS 116 human
P18857       111 STCYYHKS 118 common carp
NP_001093233 113 STCYHHKI 120 horse
P27794       110 STCYYHKF 117 European eel
AAO72302     104 STCYYHKS 111 coho salmon
P30970       110 STCYYHKI 117 yellowfin seabream
P47744       117 STCYYHKL 124 killifish
P80051        90 STCLYHKS 97  bullfrog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap