1CSG


Conserved Protein Domain Family
CSF2

?
smart00040: CSF2 
Click on image for an interactive view with Cn3D
Granulocyte-macrophage colony-simulating factor (GM-CSF)
GM-CSF stimulates the development of and the cytotoxic activity of white blood cells.
Statistics
?
PSSM-Id: 128355
View PSSM: smart00040
Aligned: 23 rows
Threshold Bit Score: 204.285
Threshold Setting Gi: 51097
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1CSG_A         1 APARSPSPSTQPWEHVNA-IQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTM 79  human
NP_999283     18 APTRPPSPVTRPWQHVDA-IKEALSLLNNSNDTAAVMNETVDVVCEMFDPQEPTCVQTRLNLYKQGLRGSLTRLKSPLTL 96  pig
Q60481        18 APTDLLSPVTQSWKHVDAtINEALSLLNHTSDPAAVMNETVEVVYDQFEPQEPTCLQTRLALFMKGLRGNLTRLEGSLTL 97  domestic guinea...
BAA04649      18 APTRPPSPVTRPWQHVDA-IKEALSLLNNSNDTAAVMNETVDIVCEMFDPQEPTCVQTRLNLYKQGLRGSLTRLKSPLTL 96  pig
XP_340800     18 APTRSPNPVTRPWKHVDA-IKEALSLLNDMRALENEKNEDVDIISNEFSIQRPTCVQTRLKLYKQGLRGNLTKLNGALTM 96  Norway rat
NP_001003245  18 APTRSPTLVTRPSQHVDA-IQEALSLLNNSNDVTAVMNKAVKVVSEVFDPEGPTCLETRLQLYKEGLQGSLTSLKNPLTM 96  dog
CAA26192      30 APTRSPITVTRPWKHVEA-IKEALNLLDDMPVT---LNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNM 105 house mouse
NP_034099     18 APTRSPITVTRPWKHVEA-IKEALNLLDDMPVT---LNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNM 93  house mouse
CAA26193      18 APTRSPITVTRPWKHVEA-IKEALNLLDDMPVT---LNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNM 93  house mouse
AAL87959      19 qtTRSPITVTRPLKHVEA-IKEALNLLDDMPVT---LNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNM 94  Expression vect...
1CSG_A        80 MASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDC 121 human
NP_999283     97 LAKHYEQHCPLTEETSCETQSITFKSFKDSLNKFLFTIPFDC 138 pig
Q60481        98 MANFYKQHCPPTPETSCMTQIITFKSFKENLKRFLFAIPFDC 139 domestic guinea pig
BAA04649      97 LAKHYEQHCPLTEETSCETQSITFKSFKDSLNKFLFTIPFDC 138 pig
XP_340800     97 IASHYQTNCPPTPETDCEIEVTTFEDFIKNLKGFLFDIPFDC 138 Norway rat
NP_001003245  97 MANHYKQHCPPTPESPCATQNINFKSFKENLKDFLFNIPFDC 138 dog
CAA26192     106 TASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFEC 147 house mouse
NP_034099     94 TASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFEC 135 house mouse
CAA26193      94 TASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFEC 135 house mouse
AAL87959      95 TASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFEC 136 Expression vector GM-C79
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap