3IZ2


Conserved Protein Domain Family
CNX

?
smart00037: CNX 
Click on image for an interactive view with Cn3D
Connexin homologues
Connexin channels participate in the regulation of signaling between developing and differentiated cell types.
Statistics
?
PSSM-Id: 128352
View PSSM: smart00037
Aligned: 30 rows
Threshold Bit Score: 80.5703
Threshold Setting Gi: 126308337
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3IZ2_A        36 EVWGDEQADFVCNTLQPGCKNVCYDHYFPISHIR 69  human
XP_543178     43 EVWGDEQSDFTCNTQQPGCENVCYDRAFPISHIR 76  dog
NP_001159768  43 EVWGDEQSDFTCNTQQPGCENVCYDRAFPISHVR 76  cattle
P51915        43 SVWGDEQSDFTCNTQQPGCENVCYDWTFPISHIR 76  Atlantic croaker
XP_001508248  43 SAWGDEQSAFRCNTQQPGCENVCYDKSFPISHVR 76  platypus
AAK58512      31 SAWGDEQSAFRCNTQQPGCENVCYDKSFPISHVR 64  chicken
NP_001079129  43 SAWGDEQSAFVCNTQQPGCENVCYDKSFPISHVR 76  African clawed frog
NP_990835     43 PLWGDEQSDFMCDTQQPGCENVCYDKAFPISHVR 76  chicken
NP_062181     43 SAWSDEQFEFHCNTQQPGCENVCYDQAFPISHVR 76  Norway rat
CAQ14841      42 SIYYDEQSKFVCNTQQPGCENVCYDAFAPLSHVR 75  zebrafish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap