Conserved Protein Domain Family
CLa

?
smart00035: CLa 
CLUSTERIN alpha chain
Statistics
?
PSSM-Id: 128350
View PSSM: smart00035
Aligned: 9 rows
Threshold Bit Score: 325.964
Threshold Setting Gi: 221042646
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 546505    227 SLMSPSHYGPP-SFHNMFQPFFEMIHQAQQAMDVQLHSPAFQFPDVDFLREGE---------DDRTVCKEIRRNSTGCLK 296
gi 261859038 280 SLMPFSPYEPL-NFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGD---------DDRTVCREIRHNSTGCLR 349
gi 126352584 228 NIMHFPMYRHL-NFNDMFQPFFDMIHQAQQAMNLHLHRLPDQLPMTEFSEGDN---------HDRTVCKEIRHNSTGCLK 297
gi 461756    227 SLMPLSHYGPL-SFHNMFQPFFDMIHQAQQAMDVQLHSPALQFPDVDFLKEGE---------DDPTVCKEIRHNSTGCLK 296
gi 47522770  228 NIMPFPLFTDL-NYHDMFQPFFDMIHQAQQAMDAHLHRIPYHFPEAGVPEN-S---------NDRAVCKEIRHNSTGCLR 296
gi 50979240  227 NIIPFPRFQPL-NFHDMFQPFFDMIHQAQQAMDVNLHRIPYHFP-IEFPEE-----------DNRTVCKEIRHNSTGCLK 293
gi 27806907  222 NVMPFPLLEPF-NFHDVFQPFYDMIHQAQQAMDAHLQRTPYHFPTMEFTEN-----------NDRTVCKEIRHNSTGCLR 289
gi 1705937   231 ELHPFFQHPMH-GFHRLFQPLFEMTQHMLDGGHGAWEHPLGGFATESRNFS-----------TDRMVCREIRRNSAGCLR 298
gi 221042646 290 TKADLEQCWDIpNFFQLFCNFSVSIYESVSETITKMLKAIEDLPKQDKAPDHGgliskmlpgQDRGLCGELDQNLSRCFK 369
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 546505    297 MKGQCEKCQEILSVDCSTNNPAQANLRQELNDSLQVAERLTEQYKELLQSFQSKMLNTSSLLEQLNDQFNWVSQLANLTQ 376
gi 261859038 350 MKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQ 429
gi 126352584 298 MKDQCEKCQEILSVDCSTNNPSQMQLRQELNNSLQLAEKFTKLYDELLQSYQEKMLNTSSLLKQLNEQFSWVSQLANLTQ 377
gi 461756    297 MKGQCEKCQEILSVDCSTNNPAQANLRQELNDSLQVAERLTQQYNELLHSLQSKMLNTSSLLEQLNDQFTWVSQLANLTQ 376
gi 47522770  297 MKDQCEKCREILSVDCSASNSSQMQLRQELYTSLQMAEKFSKLYDQLLQSYQQKMLNTSSLLKQLNEQFSWVSQLANLTQ 376
gi 50979240  294 MKDQCEKCQEILSVDCSSNNPAQVQLRQELSNSLQIAEKFTKLYDELLQSYQEKMFNTSSLLKQLNEQFSWVSQLANLTQ 373
gi 27806907  290 MKDQCEKCQEILEVDCSASNPTQTLLRQQLNASLQLAEKFSRLYDQLLQSYQQKMLNTSALLKQLNEQFTWVSQLANLTQ 369
gi 1705937   299 MRDECEKCREILAVDCSQTDPVQSQLREQFEDALRLAERFTRRYDDLLSAFQAEMLNTSSLLDQLNRQFGWVSRLGNLTQ 378
gi 221042646 370 FHEKCQKCQAHLSEDC----PDVPALHTELDEAIRLVNVSNQQYGQILQMTRKHLEDTAYLVEKMRGQFGWVSELANQAP 445
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 546505    377 GEDKYYLRVSTVT-THSSDSEVPS--RVTEVVVKLFDSDPITVVLPEEVSKDNPKFMDTVAEKALQEYR 442
gi 261859038 430 GEDQYYLRVTTVA-SHTSDSDVPS--GVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYR 495
gi 126352584 378 GEDQYYLQVTTVS-SHNSDSEVPS--GLTRVVVKLFDSYPITVTVPEVVSRNNPKFMETVAEKALQEYR 443
gi 461756    377 GDDQ-YLRVSTVT-THSSDSEVPS--RVTEVVVKLFDSDPITVVLPEEVSKDNPKFMDTVAEKALQEYR 441
gi 47522770  377 NDDRYYLQVTTVN-SHGSDPSVPS--GLTKVVVKLFDSYPITLIIPQEVS--DPKFMETVAEEALQQYR 440
gi 50979240  374 SEDPFYLQVTTVG-SQTSDSNVPV--GFTKVVVKLFDSDPITVMIPEAVSRNNPKFMETVAEKALQEYR 439
gi 27806907  370 SDDQHYLQVFTVN-SHNSDPSIPS--GLTKVIVKLFNSFPITVTVPQEVS--SPNFMENVAEKALQQYR 433
gi 1705937   379 GND-GFLQVTTVF-SKTPNLEDPSapADTQVTVQLFDSEPLSLTVPGDISWDDPRFMEIVAEQALQHYK 445
gi 221042646 446 ETEIIFNSIQVVPrIHEGNISKQD--ETMMTDLSILPSSNFTLKIPLEESAESSNFIGYVVAKALQHFK 512
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap