Conserved Protein Domain Family
CLa

?
smart00035: CLa 
CLUSTERIN alpha chain
Statistics
?
Aligned: 9 rows
Threshold Bit Score: 325.964
Threshold Setting Gi: 221042646
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAB30623     227 SLMSPSHYGPP-SFHNMFQPFFEMIHQAQQAMDVQLHSPAFQFPDVDFLREGE---------DDRTVCKEIRRNSTGCLK 296 mice
BAI46041     280 SLMPFSPYEPL-NFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGD---------DDRTVCREIRHNSTGCLR 349 synthetic const...
NP_001075413 228 NIMHFPMYRHL-NFNDMFQPFFDMIHQAQQAMNLHLHRLPDQLPMTEFSEGDN---------HDRTVCKEIRHNSTGCLK 297 horse
P05371       227 SLMPLSHYGPL-SFHNMFQPFFDMIHQAQQAMDVQLHSPALQFPDVDFLKEGE---------DDPTVCKEIRHNSTGCLK 296 Norway rat
NP_999136    228 NIMPFPLFTDL-NYHDMFQPFFDMIHQAQQAMDAHLHRIPYHFPEAGVPEN-S---------NDRAVCKEIRHNSTGCLR 296 pig
NP_001003370 227 NIIPFPRFQPL-NFHDMFQPFFDMIHQAQQAMDVNLHRIPYHFP-IEFPEE-----------DNRTVCKEIRHNSTGCLK 293 dog
NP_776327    222 NVMPFPLLEPF-NFHDVFQPFYDMIHQAQQAMDAHLQRTPYHFPTMEFTEN-----------NDRTVCKEIRHNSTGCLR 289 cattle
P14018       231 ELHPFFQHPMH-GFHRLFQPLFEMTQHMLDGGHGAWEHPLGGFATESRNFS-----------TDRMVCREIRRNSAGCLR 298 Japanese quail
BAH13000     290 TKADLEQCWDIpNFFQLFCNFSVSIYESVSETITKMLKAIEDLPKQDKAPDHGgliskmlpgQDRGLCGELDQNLSRCFK 369 human
AAB30623     297 MKGQCEKCQEILSVDCSTNNPAQANLRQELNDSLQVAERLTEQYKELLQSFQSKMLNTSSLLEQLNDQFNWVSQLANLTQ 376 mice
BAI46041     350 MKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQ 429 synthetic const...
NP_001075413 298 MKDQCEKCQEILSVDCSTNNPSQMQLRQELNNSLQLAEKFTKLYDELLQSYQEKMLNTSSLLKQLNEQFSWVSQLANLTQ 377 horse
P05371       297 MKGQCEKCQEILSVDCSTNNPAQANLRQELNDSLQVAERLTQQYNELLHSLQSKMLNTSSLLEQLNDQFTWVSQLANLTQ 376 Norway rat
NP_999136    297 MKDQCEKCREILSVDCSASNSSQMQLRQELYTSLQMAEKFSKLYDQLLQSYQQKMLNTSSLLKQLNEQFSWVSQLANLTQ 376 pig
NP_001003370 294 MKDQCEKCQEILSVDCSSNNPAQVQLRQELSNSLQIAEKFTKLYDELLQSYQEKMFNTSSLLKQLNEQFSWVSQLANLTQ 373 dog
NP_776327    290 MKDQCEKCQEILEVDCSASNPTQTLLRQQLNASLQLAEKFSRLYDQLLQSYQQKMLNTSALLKQLNEQFTWVSQLANLTQ 369 cattle
P14018       299 MRDECEKCREILAVDCSQTDPVQSQLREQFEDALRLAERFTRRYDDLLSAFQAEMLNTSSLLDQLNRQFGWVSRLGNLTQ 378 Japanese quail
BAH13000     370 FHEKCQKCQAHLSEDC----PDVPALHTELDEAIRLVNVSNQQYGQILQMTRKHLEDTAYLVEKMRGQFGWVSELANQAP 445 human
AAB30623     377 GEDKYYLRVSTVT-THSSDSEVPS--RVTEVVVKLFDSDPITVVLPEEVSKDNPKFMDTVAEKALQEYR 442 mice
BAI46041     430 GEDQYYLRVTTVA-SHTSDSDVPS--GVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYR 495 synthetic construct
NP_001075413 378 GEDQYYLQVTTVS-SHNSDSEVPS--GLTRVVVKLFDSYPITVTVPEVVSRNNPKFMETVAEKALQEYR 443 horse
P05371       377 GDDQ-YLRVSTVT-THSSDSEVPS--RVTEVVVKLFDSDPITVVLPEEVSKDNPKFMDTVAEKALQEYR 441 Norway rat
NP_999136    377 NDDRYYLQVTTVN-SHGSDPSVPS--GLTKVVVKLFDSYPITLIIPQEVS--DPKFMETVAEEALQQYR 440 pig
NP_001003370 374 SEDPFYLQVTTVG-SQTSDSNVPV--GFTKVVVKLFDSDPITVMIPEAVSRNNPKFMETVAEKALQEYR 439 dog
NP_776327    370 SDDQHYLQVFTVN-SHNSDPSIPS--GLTKVIVKLFNSFPITVTVPQEVS--SPNFMENVAEKALQQYR 433 cattle
P14018       379 GND-GFLQVTTVF-SKTPNLEDPSapADTQVTVQLFDSEPLSLTVPGDISWDDPRFMEIVAEQALQHYK 445 Japanese quail
BAH13000     446 ETEIIFNSIQVVPrIHEGNISKQD--ETMMTDLSILPSSNFTLKIPLEESAESSNFIGYVVAKALQHFK 512 human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap