Conserved Protein Domain Family
CLb

?
smart00030: CLb 
CLUSTERIN Beta chain
Statistics
?
PSSM-Id: 128345
View PSSM: smart00030
Aligned: 9 rows
Threshold Bit Score: 278.242
Threshold Setting Gi: 221042646
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62595      19 QGLVPPNELKQLSAAGSKYIDAEVENAINGVKQMKTLMDKTSKEHQAMLHTLEETKKKKEEAVKLALEKEKQLAEKQEVC 98
gi 261859038  75 DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVC 154
gi 126352584  22 DKAVSDRELQEMSTQGSNYINKEIKNALKGVKQIKNLIEQTNEERKSLLGTLEEAKKKKEGALNDTKDSEMKLKESQGVC 101
gi 50979240   23 DQAVSDTELQEMSTEGSKYINKEIKNALKGVKQIKTLIEQTNEERKSLLSNLEEAKKKKEDALNDTKDSETKLKASQGVC 102
gi 47522770   23 DKAISDKELQEMSTEGSKYVNKEIKNALKEVKQIKTLIEQSNEERKSLLSSLEEAKKKKEDALNDTRDTETKLKGSQGLC 102
gi 461756     22 EQEFSDNELQELSTQGSRYVNKEIQNAVQGVKHIKTLIEKTNAERKSLLNSLEEAKKKKEGALDDTRDSEMKLKAFPEVC 101
gi 546505     22 EQEVSDNELQELSTQGSRYINKEIQNAVQGVKHIKTLIEKTNAERKSLLNSLEEAKKKKEDALEDTRDSEMKLKAFPEVC 101
gi 27806907   17 gwAISDKELQEMSTEGSKYVNKEIKNALKEVKQIKTQIEQTNEERKLLLSSLEEAKKKKEDALNDTRDSENKLKASQGVC 96
gi 221042646  78 DKTAISENLKSFSEVGEIDADEEVKKALTGIKQMKIMMERKEKEHTNLMSTLKKCREEKQEALKLLNEVQEHLEEEERLC 157
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62595      99 NETMLSLWEECKPCLKHTCMRVYSKMCHSGSGLVGRQLEEFLNRSSPFSIWVNGE--RIDDLLDREQRQERRFEDLEERF 176
gi 261859038 155 NETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGD--RIDSLLENDRQQTHMLDVMQDHF 232
gi 126352584 102 NETMTALWEECKPCLKQTCMKFYARVCRSGSGLVGHQLEEFLNQSSPFYFWINGD--RIDSLLENDRQQTHVLDVMQDSF 179
gi 50979240  103 NDTMMALWEECKPCLKQTCMKFYARVCRSGSGLVGHQLEEFLNQSSPFYFWMNGD--RIDSLLENDRQQTHALDVMQDSF 180
gi 47522770  103 NETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGHQLEEFLNQSSPFYFWINGD--RIDSLMENDRQQSHVMDIMEDSF 180
gi 461756    102 NETMMALWEECKPCLKHTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGD--RIDSLLESDRQQSQVLDAMQDSF 179
gi 546505    102 NETMMALWEECKPCLKHTCMKFYARVCRSGSGLVGQQLEEFLNQSSPFYFWMNGD--RIDSLLESDRQQSQVLDAMQDSF 179
gi 27806907   97 NETMTALWEECKPCLKQTCMKFYARVCRSGSGLVGHQLEEFLNQSSPFYFWINGD--RIDSLMENDREQSHVMDVMEDSF 174
gi 221042646 158 RESLADSWGECRSCLENNCMRIYT-TCQPSWSSVKNKIERFFRKIYQFLFPFHEDneKDLPISEKLIEEDAQLTQMEDVF 236
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 62595     177 GLMEDGVEDIFQDSTQLY----GPAFPFFRTPPFGGFREafvppvqRVHLVPR-RRLSR 230
gi 261859038 233 SRASSIIDELFQDRFFTR----EPQDTYHYLPFSLPHRR-------PHFFFPK-SRIVR 279
gi 126352584 180 DRASSIMDELFQDRFFTR----EPQDTYYYSPFSSPHRRs------SLLFNPK-SRFAR 227
gi 50979240  181 NRASSIMDELFQDRFFTR----EPQDTYHYSPFSLFQRR--------PFFNPK-FRIAR 226
gi 47522770  181 NRASNIMDELFQDRFFNR----EPFDTQFFSPFGSSHRG-------SLFFNPK-SRFAR 227
gi 461756    180 TRASGIIDTLFQDRFFTH----EPQDIHHFSPMGFPHKR-------PHFLYPK-SRLVR 226
gi 546505    180 ARASGIIDTLFQDRFFAR----ELHDPHYFSPIGFPHKR-------PHFLYPK-SRLVR 226
gi 27806907  175 TRASSIMDELFQDRFFLR----RPQDTQYYSPFSSFPRG-------SLFFNPK-SRFAR 221
gi 221042646 237 SQLTVDVNSLFNRSFNVFrqmqQEFDQTFQSHFISDTDLt------EPYFFPAfSKEPM 289
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap