Conserved Protein Domain Family
CLb

?
smart00030: CLb 
CLUSTERIN Beta chain
Statistics
?
Aligned: 9 rows
Threshold Bit Score: 278.242
Threshold Setting Gi: 221042646
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAA33823      19 QGLVPPNELKQLSAAGSKYIDAEVENAINGVKQMKTLMDKTSKEHQAMLHTLEETKKKKEEAVKLALEKEKQLAEKQEVC 98  common quail
BAI46041      75 DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVC 154 synthetic const...
NP_001075413  22 DKAVSDRELQEMSTQGSNYINKEIKNALKGVKQIKNLIEQTNEERKSLLGTLEEAKKKKEGALNDTKDSEMKLKESQGVC 101 horse
NP_001003370  23 DQAVSDTELQEMSTEGSKYINKEIKNALKGVKQIKTLIEQTNEERKSLLSNLEEAKKKKEDALNDTKDSETKLKASQGVC 102 dog
NP_999136     23 DKAISDKELQEMSTEGSKYVNKEIKNALKEVKQIKTLIEQSNEERKSLLSSLEEAKKKKEDALNDTRDTETKLKGSQGLC 102 pig
P05371        22 EQEFSDNELQELSTQGSRYVNKEIQNAVQGVKHIKTLIEKTNAERKSLLNSLEEAKKKKEGALDDTRDSEMKLKAFPEVC 101 Norway rat
AAB30623      22 EQEVSDNELQELSTQGSRYINKEIQNAVQGVKHIKTLIEKTNAERKSLLNSLEEAKKKKEDALEDTRDSEMKLKAFPEVC 101 mice
NP_776327     17 gwAISDKELQEMSTEGSKYVNKEIKNALKEVKQIKTQIEQTNEERKLLLSSLEEAKKKKEDALNDTRDSENKLKASQGVC 96  cattle
BAH13000      78 DKTAISENLKSFSEVGEIDADEEVKKALTGIKQMKIMMERKEKEHTNLMSTLKKCREEKQEALKLLNEVQEHLEEEERLC 157 human
CAA33823      99 NETMLSLWEECKPCLKHTCMRVYSKMCHSGSGLVGRQLEEFLNRSSPFSIWVNGE--RIDDLLDREQRQERRFEDLEERF 176 common quail
BAI46041     155 NETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGD--RIDSLLENDRQQTHMLDVMQDHF 232 synthetic const...
NP_001075413 102 NETMTALWEECKPCLKQTCMKFYARVCRSGSGLVGHQLEEFLNQSSPFYFWINGD--RIDSLLENDRQQTHVLDVMQDSF 179 horse
NP_001003370 103 NDTMMALWEECKPCLKQTCMKFYARVCRSGSGLVGHQLEEFLNQSSPFYFWMNGD--RIDSLLENDRQQTHALDVMQDSF 180 dog
NP_999136    103 NETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGHQLEEFLNQSSPFYFWINGD--RIDSLMENDRQQSHVMDIMEDSF 180 pig
P05371       102 NETMMALWEECKPCLKHTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGD--RIDSLLESDRQQSQVLDAMQDSF 179 Norway rat
AAB30623     102 NETMMALWEECKPCLKHTCMKFYARVCRSGSGLVGQQLEEFLNQSSPFYFWMNGD--RIDSLLESDRQQSQVLDAMQDSF 179 mice
NP_776327     97 NETMTALWEECKPCLKQTCMKFYARVCRSGSGLVGHQLEEFLNQSSPFYFWINGD--RIDSLMENDREQSHVMDVMEDSF 174 cattle
BAH13000     158 RESLADSWGECRSCLENNCMRIYT-TCQPSWSSVKNKIERFFRKIYQFLFPFHEDneKDLPISEKLIEEDAQLTQMEDVF 236 human
CAA33823     177 GLMEDGVEDIFQDSTQLY----GPAFPFFRTPPFGGFREafvppvqRVHLVPR-RRLSR 230 common quail
BAI46041     233 SRASSIIDELFQDRFFTR----EPQDTYHYLPFSLPHRR-------PHFFFPK-SRIVR 279 synthetic construct
NP_001075413 180 DRASSIMDELFQDRFFTR----EPQDTYYYSPFSSPHRRs------SLLFNPK-SRFAR 227 horse
NP_001003370 181 NRASSIMDELFQDRFFTR----EPQDTYHYSPFSLFQRR--------PFFNPK-FRIAR 226 dog
NP_999136    181 NRASNIMDELFQDRFFNR----EPFDTQFFSPFGSSHRG-------SLFFNPK-SRFAR 227 pig
P05371       180 TRASGIIDTLFQDRFFTH----EPQDIHHFSPMGFPHKR-------PHFLYPK-SRLVR 226 Norway rat
AAB30623     180 ARASGIIDTLFQDRFFAR----ELHDPHYFSPIGFPHKR-------PHFLYPK-SRLVR 226 mice
NP_776327    175 TRASSIMDELFQDRFFLR----RPQDTQYYSPFSSFPRG-------SLFFNPK-SRFAR 221 cattle
BAH13000     237 SQLTVDVNSLFNRSFNVFrqmqQEFDQTFQSHFISDTDLt------EPYFFPAfSKEPM 289 human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap