Conserved Protein Domain Family
EPEND

?
smart00026: EPEND 
Ependymins
Ependymins are the predominant proteins in the cerebrospinal fluid (CSF) of teleost fish. They have been implicated in the neurochemistry of memory and neuronal regeneration. They are glycoproteins of about 200 amino acids that can bind calcium. Four cysteines are conserved that probably form disulfide bonds.
Statistics
?
PSSM-Id: 128341
View PSSM: smart00026
Aligned: 11 rows
Threshold Bit Score: 324.892
Threshold Setting Gi: 416955
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
NP_001118166  27 QHCTSPNMTGVLTVMALTGGEIKATGHYSYDSTNKKLRFTESEMHLNKTEHLeDYLMLFEEGVFYDIDMKNQSCKKMSLH 106 rainbow trout
P38528        25 QPCHSPPLTSGTMKVVSTGGHDLASGEFSYDSKANKFRFVEDTAHANKTSHM-DVLVHFEEGVLYEIDSKNESCKKETLQ 103 common carp
Q90399        28 QPCHSPQLTSGTMKVISTGGHDLASGEFNYDSKANKFRFVEDTTHANKTSYM-DVLVHFEEGVLYEIDSKNESCKKETLQ 106 giant danio
AAA49165      26 QPCHSPPLISGTMKVVSTGGHDLASGEFSYDSKANKFRFVEDAAHANKTSHT-DVLVHFEEGTLYEIDSKNESCKKETLQ 104 goldfish
CAA32352      26 QPCHAPPLTSGTMKVVSTGGHDLESGEFSYDSKANKFRFVEDTAHANKTSHM-DVLIHFEEGVLYEIDSKNESCKKETLQ 104 goldfish
Q91130        25 QPCHSPPLTSGTMKVVSTGGHDLASGEFSYDSKASKFRFVEDT-HANKTSHM-DVLIHFEEGTLYEIDSKNESCKKETLQ 102 golden shiner
CAA36742      27 QPCHSPQLTSGTMKVVSTGGHDLASGEFSYDSKTNKFRFVEDTTHANKTSYI-DVLIHFEEGVLYEIDSKNESCKKETLQ 105 zebrafish
NP_001118165  27 QHCTSPNMTGVLTVLALTGGEIKATGHYSYDSTDKKIRFTESEMHLNKTEHLeDYLMLFEEGVFYDIDMKNQSCKKMSLH 106 rainbow trout
P28772        27 QHCTSPNMTGVLTVMALTGGEIKATGHYSYDSTDKKLRFTESEMHLNKTEHLeDYLMLFEEGVFYDIDMKNQSCKKMSLH 106 Atlantic salmon
P32188        31 QHCTSPNMTGVLTVMALNGGEIKATGHYHYDTTDKKLRFTESDMHLNKSEHLeDYLMLFEEGVFYDIDLKNQSCRKMSLQ 110 northern pike
P32187        23 QPCRPPPQTHGNLWVTAAKGAPASVGEFNYDSQARKLHFKDDALHVNKTDHL-EMLIFFEEGIFYDIDSHNQSCHKKTLQ 101 Atlantic herring
NP_001118166 107 SHAHALELPAGAAHQVELFLGSDTVQEDNIKVNIWMGSVAETKGQYSALTTVGECLPLSTFYSTD-SITLLFSNSEVVTE 185 rainbow trout
P38528       104 FRKHLMEIPPDATHESEIYMGSPSITEQGLRVRVWNGKLPELHAHYSLSTTSCGCLPVSGSYYGD-KKDLLFSFFGVETE 182 common carp
Q90399       107 FRKHLMEIPPDATHESEIYMGSPSITEQGLRVRVWNGKLPELHAHYSLSTTSCGCLPVSGSYYGE-KKDLFFSFFGVETE 185 giant danio
AAA49165     105 FRKHLMEIPPDATHESEIYMGSPSITEQGLRVRVWSGKLPELHAHYSLSITSCGCLPVSGSYYGD-KKDLLFSFFGVETE 183 goldfish
CAA32352     105 FRKHLMEIPPDATHESEIYMGSPSITEQGLRVRVWNGKFPELHAHYSMSTTSCGCLPVSGSYHGE-KKDLHFSFFGVETE 183 goldfish
Q91130       103 FRKHLMEIPPDATHESEIYMGSPTVIEQGLRVRVWHGKLPELHAHYSLSTTSCGCLPVSGSFYGK-KKDLLFSFFGVEPE 181 golden shiner
CAA36742     106 FRKHLMEIPVDATHESESYMGSPSLTEQGLRVRVWNGKFPELHAHYSLSTTSCGCLTVSGSYYGE-KKDLFFSFFGVETE 184 zebrafish
NP_001118165 107 SHAHALELPAGAAHQVELFLGSDTVQEEDIKVNIWTGSVPETKGQYFLSTTVGECLPLSTFYSTD-SITLLFSNSEVVTE 185 rainbow trout
P28772       107 SHAHALELPAGAAHQVELFLGSDTVQEENIKVNIWMGSVAETKGQYSVLTTVGECLPLSTFYSTD-SITLLFSNSEVVTE 185 Atlantic salmon
P32188       111 SHAHALELPAGAVHQVELFLGSDTVQEENIKVNIWMGSVPETKGQYSVSTTVGDCLPLSTFYSTD-SITLLFSNSQVVTE 189 northern pike
P32187       102 STYHCLEVPPNATHVTEGYLGSEFIGDQGVRMRKWRKRVPELDGVVTVATTSCGCVTLFATLFTDsNDVLVFNFLDVEMK 181 Atlantic herring
NP_001118166 186 VKAP-EMFTLPSFCEAVELEETPKGqkNDFFNIFNT 220 rainbow trout
P38528       183 VDDP-QVFVPPAYCEAVAFEEAPDD--HSFFDLFHD 215 common carp
Q90399       186 VDDP-QVFVPPAYCEGVSFEEAPDD--HSFFDLFHD 218 giant danio
AAA49165     184 VDDL-QVFVPPAYCEGVAFEEAPDD--HSFFDLFHD 216 goldfish
CAA32352     184 VDDL-QVFVPPAYCEGVAFEEAPDD--HSFFDLFHD 216 goldfish
Q91130       182 VDDP-QAFVPPAYCEGVSFEEAPDD--HSFFDLFHD 214 golden shiner
CAA36742     185 VDDL-QVFAPPAYCEGVSFEEAPDD--HSFFDLFHD 217 zebrafish
NP_001118165 186 VKAP-EVFNLPSFCEGVELEEAPEGqkNDFFSLFNS 220 rainbow trout
P28772       186 VKAP-EMFTLPSFCEAVELEETPKGqkNDFFNIFNT 220 Atlantic salmon
P32188       190 VKEP-EVFSLPSFCEGLELEDT--H--NDFFSIFNT 220 northern pike
P32187       182 VKNPlEVFVPPSYCDGVALEEEGD----TFFGLFH- 212 Atlantic herring
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap