1LPB


Conserved Protein Domain Family
COLIPASE

?
smart00023: COLIPASE 
Click on image for an interactive view with Cn3D
Colipase
Colipase is a protein that functions as a cofactor for pancreatic lipase, with which it forms a stoichiometric complex. It also binds to the bile-salt covered triacylglycerol interface thus allowing the enzyme to anchor itself to the water-lipid interface. Colipase is a small protein of approximately 100 amino-acid residues with five conserved disulfide bonds.
Statistics
?
PSSM-Id: 128339
View PSSM: smart00023
Aligned: 10 rows
Threshold Bit Score: 151.524
Threshold Setting Gi: 224458360
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1LPB_A         1 VPDPRGIIINLDEGELCLNSAQCKSNCCQHDTILSLSRCALKARENSECSAFTLYGVYYKCPCERGLTCEGDKSLVGSIT 80  pig
AAP36174      18 APGPRGIIINLENGELCMNSAQCKSNCCQHSSALGLARCTSMASENSECSVKTLYGIYYKCPCERGLTCEGDKTIVGSIT 97  synthetic const...
NP_001003287  18 vPDPRGIIIHLEDGELCLNSVQCKSKCCHRATGLSLARCAPKASENSECSAKTLYGVYYKCPCERGLTCEGDKSIVGSIT 97  dog
AAA40943      18 VPGPRGLFINLEDGEICVNSMQCKSRCCQHDTILGIARCTHKAMENSECSPKTLYGIYYRCPCERGLTCEGDRSIIGAIT 97  Norway rat
P02704        12 VPDPRGVIINLEAGEICLNSAQCKSECCHQESSLSLARCAAKASENSECSAWTLYGVYYKCPCERGLTCQVDKTLVGSIM 91  horse
P42889        18 APDPRGLIINLDNGELCLNSAQCKSQCCQHDSPLGLARCADKARENSGCSPQTIYGIYYLCPCERGLTCDGDKSIIGAIT 97  nutria
NP_001157487  18 vPDPRGVIINLEAGEICMNSAQCKSECCHRESSLSLARCAAKASENSECSAWTLYGVYYKCPCERGLTCQVDKTLVGSIM 97  horse
NP_001138963  20 aPSERGLIFNLDTGELCLQSAQCKSGCCQRDSGLSLARCSPKAAETQDCSRKSLYGVYYKCPCESGLSCDADWSIVGSIT 99  chicken
P11149         1 APE-RGLFLNLSAGELCVGSFQCKSSCCQRETGLSLARCA---------------------------------------- 39  spiny dogfish
NP_001075712  18 APGPRGIVINLEEGELCLNSAQCKSGCCHHSSALSLARCAPKASENSECSPQTIYGVYYKCPCERGLTCEGDKSIVGSIT 97  rabbit
1LPB_A        81 NTNFGICHNVGRSDS 95  pig
AAP36174      98 NTNFGICHDAGRSKQ 112 synthetic construct
NP_001003287  98 NTNFGVCHDAGRSKK 112 dog
AAA40943      98 NTNYGVCLDSTRSKQ 112 Norway rat
P02704        92 NTNFGICFDAARSEE 106 horse
P42889        98 NTNYGICQDPQSKK- 111 nutria
NP_001157487  98 NTNFGICFDAARSEE 112 horse
NP_001138963 100 NTDYGVCYDkrdpts 114 chicken
P11149           ---------------     spiny dogfish
NP_001075712  98 NTNFGVCLDV----- 107 rabbit
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap