Conserved Protein Domain Family
SF_P

?
smart00019: SF_P 
Pulmonary surfactant proteins
Pulmonary surfactant associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-C, a component of surfactant, is a highly hydrophobic peptide of 35 amino acid residues which is processed from a larger precursor protein. SP-C is post-translationally modified by the covalent attachment of two palmitoyl groups on two adjacent cysteines
Statistics
?
PSSM-Id: 128335
View PSSM: smart00019
Aligned: 5 rows
Threshold Bit Score: 328.09
Threshold Setting Gi: 1709878
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P11686         1 MDVGSKEVLMESPPDYSAAPRGRFGIPCCPVHLKRLLIVVVVVVLIVVVIVGALLMGLHMSQKHTEMVLEMSIGAPEAQQ 80  human
NP_001036224   1 MDVGSKEVLMESPPDYSAAPRGRFGIPCCPVHLKRLLIVVVVVVLVVVVIVGALLMGLHMSQKHTEMVLEMSIGAPEAQQ 80  rhesus monkey
P35245         1 MDVGSKEVLIENPPDYSAAPQGRFGLPCFPSSLKRLLIIVVVIVLVVVVIVGALLMGLHMSQKHTEMVLEMSLGGPEAQQ 80  mink
P21841         1 MDMSSKEVLMESPPDYSAGPRSQFRIPCCPVHLKRLLIVVVVVVLVVVVIVGALLMGLHMSQKHTEMVLEMSIGAPETQK 80  house mouse
P22398         1 MDMGSKEALMESPPDYSAAPRGRFGIPCCPVHLKRLLIVVVVVVLVVVVIVGALLMGLHMSQKHTEMVLEMSIGAPEVQQ 80  rabbit
P11686        81 RLALSEHLVTTATFSIGSTGLVVYDYQQLLIAYKPAPGTCCYIMKIAPESIPSLEALNRKVHNFqmecslQAKPAVPTSK 160 human
NP_001036224  81 HLARSGHLVTTATFSFGSTGLVVYDYQRLLIAYKPAPGTWCYIMKTAPESIPSLEALTRKVQNF------QAKPAVPTSK 154 rhesus monkey
P35245        81 RLALQERAGTTATFSIGSTGIVVYDYQRLLIAYKPAPGTCCYIMKMAPENIPSLEALTRKFQNF------QVKPAVSTSK 154 mink
P21841        81 RLAPSERADTIATFSIGSTGIVVYDYQRLLTAYKPAPGTYCYIMKMAPESIPSLEAFARKLQNF------RAKPSTPTSK 154 house mouse
P22398        81 RLALSEWAGTTATFPIGSTGIVTCDYQRLLIAYKPAPGTCCYLMKMAPDSIPSLEALARK---F------QANPAEPPTQ 151 rabbit
P11686       161 LGQAEGRDAGSA--PSGGDPAFLGMAVNTLCGEVPLYYI 197 human
NP_001036224 155 LDQVEGRDAGSA--PSRGDLAFLGMAVSTLCGEVPLYYI 191 rhesus monkey
P35245       155 LGQEEGHNAGSA--SPG-DLDFLGTTVSTLCGEVPLYYI 190 mink
P21841       155 LGQEEGHDTGSEsdSSGRDLAFLGLAVSTLCGELPLYYI 193 house mouse
P22398       152 RGQDKGPAAGPA--SSGGELAFLGAAVSTLCGEVPLIYI 188 rabbit
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap