Conserved Protein Domain Family
SeqA_N

?
pfam17206: SeqA_N (This model is not part of the current CDD release)
SeqA protein N-terminal domain
The binding of SeqA protein to hemimethylated GATC sequences is important in the negative modulation of chromosomal initiation at oriC, and in the formation of SeqA foci necessary for Escherichia coli chromosome segregation. SeqA tetramers are able to aggregate or multimerise in a reversible, concentration-dependent manner. Apart from its function in the control of DNA replication, SeqA may also be a specific transcription factor. This short domain mediates dimerization.
Statistics
?
PSSM-Id: 522755
Aligned: 6 rows
Threshold Bit Score: 64.4357
Created: 19-Feb-2025
Updated: 28-Apr-2025
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_025422951   1 MKTIEVDEDLYRYIAGHTQHIGESASDILRRMLKFT 36  Sodalis praecaptivus
WP_012604536   1 MKTIEVDEDLYRFIAGQTERIGESASDILRRLLLVD 36  Vibrio
Q082Q5         1 MKYIEIDEELYRFIASKTERIGESASDILRRLLNLS 36  Shewanella frigidimarina NCIMB 400
Q3IGV1         1 MKQIDIDDELYQYIASNTQSIGESASTILRRLLNLS 36  Pseudoalteromonas translucida TAC125
A1STA5         1 MKNIEIEDDLYKYILANIEAFGETPSQILRRLLSLP 36  Psychromonas ingrahamii 37
F2EP55         1 MKTIEVDEELYRYIASHTQHIGESASDILRRMLKFt 36  Pantoea ananatis AJ13355
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap