Conserved Protein Domain Family
HHV-1_VABD
?
pfam16852: HHV-1_VABD 
Herpes viral adaptor-to-host cellular mRNA binding domain
HHV-1_VABD is the short region of the Herpes simplex 1 virus' specific signature adaptor protein that binds to the cellular mRNA export factor such as mouse REF.
Links
?
Statistics
?
PSSM-Id: 293457
Aligned: 2 rows
Threshold Bit Score: 66.2963
Created: 17-Feb-2025
Updated: 28-Apr-2025
Structure
?
Aligned Rows:
Download Cn3D
PubMed ReferencesClick to see Conserved Features Help
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection: 
P28276  97 PPPATtgVWSRLGTRRSASPREPHGGKVARIQPPSTKAPHPR 138 Human herpesvirus 2 strain HG52
P10238  99 PAPHS--VWSRLGARRPSCSPEQHGGKVARLQPPPTKAQPAR 138 Human alphaherpesvirus 1 strain 17
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap