Conserved Protein Domain Family
Eisosome1

?
pfam12757: Eisosome1 
Eisosome protein 1
Eisosome protein 1 is required for normal formation of eisosomes, large cytoplasmic protein assemblies that localize to specialized domains on plasma membrane and mark the site of endocytosis.
Statistics
?
PSSM-Id: 403840
View PSSM: pfam12757
Aligned: 83 rows
Threshold Bit Score: 72.6171
Threshold Setting Gi: 146453334
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EJT77574     471 REALLAAARRNVKAQLEGLDRKLLADsgkvPPSLLSEWETKAHAAALARtgggsacatspasttvagptttprielssAD 550  Gaeumannomyces...
XP_001383011 231 nSTLLSAANERANERLQSI-SSTPQD----LKAQAQQYAS-ALAVAQKN-----------------------------SD 275  Scheffersomyce...
EGW31346     238 NATLLQAANNKANERLNSISAQTPLN----VKQQAQLYAK-ALAVAQKN-----------------------------SD 283  Spathaspora pa...
EDK43951     251 tPALLAAAAAKADQRLSALNNNSPQS----LKQQAQLYAN-ALAIAQKN-----------------------------SD 296  Lodderomyces e...
CCE40189     249 nSTLLAAAAAKANDRLSTLNANTPQS----LKAQAQLYAN-ALAVAQKN-----------------------------SD 294  Candida paraps...
XP_002548343 244 NASLLKAANEKANVRLNSIKSSNPAT----LKAQAQLYAN-ALALAQQR-----------------------------SD 289  Candida tropic...
Q6BYM2       232 ygNLLVAANSKAQDRLKSLNSSTSKD----FREQAKEYAG-ALAIAQKN-----------------------------SD 277  Debaryomyces h...
CCE88691     244 yPNLLQAANGKAQERLKTINSSSPAD----FKQKAQLYAN-ALALAQKR-----------------------------SD 289  Millerozyma fa...
XP_011275486 245 DPKVLAQARLNADHTLSGIDKNLGEK----DLFLNPEFNAKAIELAKQK-----------------------------YE 291  Wickerhamomyce...
CAY69371     287 DAKVLQKALANAESTLRRLDTDATPE----NLFNNRENNLKALAIAQQN-----------------------------SE 333  Komagataella p...
EJT77574     551 TRSGNN-AGKIDIGGGKFMDQTEIDEIAARRVQPFLDEINDKAEKERERLAALRAEEERKRAEAEGKRAQEREIK 624  Gaeumannomyces trit...
XP_001383011 276 ERVKNYkAGVIDLGGGLTILQSELDKMASLVVQPVLNDISSKASAKREADLQKKVAQKELETQHQLAKQEEWKEK 350  Scheffersomyces sti...
EGW31346     284 ERLKSHqAGVINLGGGLTITQTQLDQLASSYVQPILKDIESKADLKRQDDLEKKQKQLELEEAHQRAKQEEVEAK 358  Spathaspora passali...
EDK43951     297 ERSKNRqAGLINLGGGLTISIAELDKLAATYVQPVIDDIETKADSKRQIQAEKKQRKLELKAAHERAKQEEHAAK 371  Lodderomyces elongi...
CCE40189     295 ERAKNRvAGVINLGGGLTITQAELNQLAATYVQPVIDDIEQKADSKREIELSKKQRKAELKAAHERAKQEQQAAK 369  Candida parapsilosis
XP_002548343 290 ERVKNYqTGMVNLGGGLTISQAELDNLASTYVQPILSDIEGKAEAKRQVDLEKQQRQLELKQKHEDAKRQEKEAK 364  Candida tropicalis ...
Q6BYM2       278 ERMKNNkAGMVDLGGGLTMSLTDLDAKAALVVGPVLSDIESKAVAQREADEQTKTKHAKLVGLHQKSKQEEQARK 352  Debaryomyces hansenii
CCE88691     290 DRIKQNvEGVINLGGGLTITRNEINKKASLIVDPVLVDIENKAKNQRDIDEANALKKKELHELHEKAKQEEIDRK 364  Millerozyma farinos...
XP_011275486 292 NRSTT--LGKVDLGGGLFMSQEELDAIASKIVNPVLEDINSKAKLQRDRDAELNKQKQEQLNKERRFKIEQQTKK 364  Wickerhamomyces cif...
CAY69371     334 KRRVN--DGKIDLGGGLFMDPVELNVMAQQLVGPVVQQIDSKAALQRQQDEQNAQKKLEQKQRKLQYEEELRKQK 406  Komagataella phaffi...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap