Conserved Protein Domain Family
Hid1

?
pfam12722: Hid1 
High-temperature-induced dauer-formation protein
Hid1 (high-temperature-induced dauer-formation protein 1) represents proteins of approximately 800 residues long and is conserved from fungi to humans. It contains up to seven potential transmembrane domains separated by regions of low complexity. Functionally it might be involved in vesicle secretion or be an inter-cellular signalling protein or be a novel insulin receptor.
Statistics
?
PSSM-Id: 403812
View PSSM: pfam12722
Aligned: 17 rows
Threshold Bit Score: 816.649
Threshold Setting Gi: 211999892
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6BSE0                 1 MKTAEERLRFKNHFFKLGQGRLI--PSSDStYWDAFW-KEPETTSDIYELITPYDIRTIREQNRANFVLMIRVLILRLTY 77   Debary...
ABN67750               1 MKTADDKLRYKNHFFKLGQGRVI--AGNDSdYWKVLW-TEPDNSDDIFELLTSYDIRTIRDQNRVNYLVMIHVLCNQIIA 77   Scheff...
XP_002643863           1 MGAQGSRVDFKQAVLDLTSKPGKddEQ----FWDQAW--WPDTVNDIFAMIPGEDIRKLRDESPKNLATLVYKAVEKIQF 74   Caenor...
Q0E9B5                 1 MGNTDSKLNFRKAIVQLTQKNQKidPSDEQ-FWEQFWqGHQTTLEDVFALVTSSEIRQIRNENPANLATLCYKAVEKLAQ 79   fruit fly
EDS35074               1 MGNADTKLNFRKAIVQLTSKSQPidASDDA-FWEQFWcEHSTTVQDVFALIPSNEVRKVRDVMPTNLATLCYKATERLVR 79   southe...
EEN51597               1 MGNSDTKLNFRKAVIQLTTKTQPveAQDEA-FWDQFWtDSVTSVQDVFALVPAAEIRALREESPSNLATLCYKAVEKLVM 79   Florid...
EDO48052               1 MGGTESKLNFRKAVVQLTTKKSAaePNDDA-FWDQFWsESAATISDVFTLIPAAEIRNLRDENPSNLATL---------- 69   starle...
WGS:AATM:SJAG_00567    1 MGAQESKLCFRRAVLRL--------------YEERFW-RFSNTAKDVFNLLPLKDIRKTRDLAFENLQTLIILLCHRIIA 65   Schizo...
Q9P7M6                 1 MGSQQSKLDFRNAVLRLHEERNI--PKFDL-IWERLW-TLPETTEDVFHLMSIDDLTKVKDNAPENLQTIIAVLWDKLED 76   Schizo...
Q5ASC1                 1 MGASESKLVFKQGIFRLSEEKEI--PPDDP-YWARFW-ELPESTEDVFSLFTPADIRRTRDHALGNFETLLLSITSRLTT 76   Asperg...
Q6BSE0                78 LAQHENFPS-KDAPVS--ELLNCIRFLTKLLPFVFElPEYCSELDDILFWSETFDPMTVATgSSLNNIQTPVSVLGgeke 154  Debary...
ABN67750              78 TARDSEFPS-SKSPLSirQLLTCIRLLVKLIPFLYEiPEYTQEIEPRLFWVENFDPLVFIKpSTFASLSSSTSQPClt-- 154  Scheff...
XP_002643863          75 SRHHP-----ANIDQK--KVINAIRLLTRITPYMLE----DAEWRG-YFWSPIPH------------------------- 117  Caenor...
Q0E9B5                80 AVDSSCR---TQAEQQ--CVLNCVRLLVRCLPYIFE----DEKWRD-FFWSSLPS------------------------- 124  fruit fly
EDS35074              80 AVDNSCR---TQGEQQ--TVLNCVRLLNRVLPYIFE----DAQWKD-FFWSSLPAGNek--------------------- 128  southe...
EEN51597              80 AAESSCA---TAKEQQ--TVLNCVRLLTRILPYIFE----DADWRG-FFWSTLPGqa----------------------- 126  Florid...
EDO48052              70 ------------------SRVFCVRLLTRFIPYIFE----DPDWRG-FFWSTIPsq------------------------ 102  starle...
WGS:AATM:SJAG_00567   66 CSSDPNLVEpSNVLVT--QLLNAVRILTRVLPVVFE-TEIGSSWIESVFWTINDKNKR---------------------- 120  Schizo...
Q9P7M6                77 LQKETLFDDpAAPTTK--CALNCMRLLTRLMPIIFE-DKSMLEWFDYFAWTVPKDPNINT-------------------- 133  Schizo...
Q5ASC1                77 LKNHPSFPDpDLAPDR--DALNCIRILTRLLPYIYE-AEHLEQWEEKFFWTRRKKKTREAQ-LAADVLFDESQVEEvrdr 152  Asperg...
Q6BSE0               155 ---nektVNKENILGVNIVKCLVDLLFIRSFTMDVPIgd------egRSGSKRMMSVWEPGIGTTAKYQTpNLIIDSNRM 225  Debary...
ABN67750             155 ------kESIHNVTAVQLMRALVDLLFIRTFTIDAP-----------RSKSNKILSVWEPGIGTSSKYLApNLIIDSNRA 217  Scheff...
XP_002643863         118 -------GDSTKPLAAVLLENLSDLLFCPEFTISHSNglkv---ndlSTIDSCEY-IWEAGVGSGNKPPM-VALHYQNRS 185  Caenor...
Q0E9B5               125 -------QDKTMPLAQSLLNATCDLLFCPDFTVTATRragpekaeelANIDSCEY-IWEAGVGFAQSPPH-NAHMERRRT 195  fruit fly
EDS35074             129 ------eEPTAAPLAQSLLNAICDLLFCPDFTVVGLRksgpekaeelNSIDSCEY-IWEAGVGFAQSPPR-NGHMDARRT 200  southe...
EEN51597             127 ------eDGGSMPLAQSLLNALSDLLFCPDFTVAPNKkagpethedlQSIDSCEY-IWESGVGFAHSPAQ-YPHHDQNRS 198  Florid...
EDO48052             103 ------ePEGQTPLAQTLLDALADLCFCPEFTVHPNKkagpeqhedlSSIDSCEY-IWEAGVGFATSPPS-NAQFDCNRA 174  starle...
WGS:AATM:SJAG_00567  121 ------------ALGEQVMDSLLYLLFYVGFTIPAVD----------YKSKGVQLCIWETGVGCNTLLTS-KHSYEQNKI 177  Schizo...
Q9P7M6               134 ------------PRGASFLNTVVDYLFLINFTIPAHN----------DLTHGVHYCIWETGVVYHPTMLK-ERSYELHRV 190  Schizo...
Q5ASC1               153 asprvneYEDVKPLAEELIDTLMDLLFYTGFTIPKLP----------SAKAKVSYSIWQSGVGCNTSMGS-TRELEDNRC 221  Asperg...
Q6BSE0               226 EVLKLMLVLMTTSVYLVPSQvV-SNGSKFLTLLVATTPRVELLILVCSLMNLLCRSARSPve-eNMLFY-RNIELTEMRH 302  Debary...
ABN67750             218 EVLKLLLTLCSSTFYNTPSEvV-SAGSKFMTLLVTSTPRVELLTLVCSLTNLVCRSTRSSpe-dNALSYpSNSQLTEMRH 295  Scheff...
XP_002643863         186 EILKLLLTCFSEVIYAPV---SdENRLRWICHFTAVTNPH-VLPIFTSLLNIVCAYDPVG----YGLPY-NYLLFNDSRE 256  Caenor...
Q0E9B5               196 ELLKLLLTCFSEPMYRSPQ--QsEEPNKWIAYFTSADNRH-ALPLFTSFLNTVCSYDPVG----FGVPY-NHLLFADTTE 267  fruit fly
EDS35074             201 ELLKLLLTCFSETMYRVPN--MsDEPNKWIVHFTSADNRH-ALPLFTSLLNTVCAYDPVG----IGVPY-NHLLFTDTLE 272  southe...
EEN51597             199 EILKLLLTCFSETMYQPPGd---PLPNQWLTYFASSENRH-ALPLFTSLLNIVCAYDPIG----YGMPY-NHLLFSDYRE 269  Florid...
EDO48052             175 ELLKLLLTCFSEAMYLPPTPeNhTRPNKWLCYFASSENRH-ALPLFTSILNTVCSYDPLG----YGVPT-------DFKE 242  starle...
WGS:AATM:SJAG_00567  178 EILLLLLVLFSETMYREr-----SHSSSYLAYVISHNNSDLSLSLLCSLLNTAMQFNTSFwkprSVMSA-HLATHA---- 247  Schizo...
Q9P7M6               191 EVLRLLLSLFSEEIYRTd-----GNGSSCCAYVASIANRRLVLCLLSSLINTAMRFNTMFwk-pEFLPLdNSVAHM---- 260  Schizo...
Q5ASC1               222 EVLRLLLTITGKAMYMSSSL-LpVQGVRAITYITTSQEKQAVLTLLCSLLNTAIKYNPAS----WRVPY-DHVVWKDPRQ 295  Asperg...
Q6BSE0               303 LCVTYATQLLTLMIVYPLPSQPNLqflydl-------nllttAKPFNMARVYIGKLRKENELLFLASYLINVLRAPMQss 375  Debary...
ABN67750             296 LTVTYSIQLLTAMVVYPLPSPEKLdflket-------elistSKPGNLARLYMGKLHKDQELVFLSTYLIAILKLPVVts 368  Scheff...
XP_002643863         257 PLVEIALQVLIVCLDKESQPKTDDsg-----------------yQDNYFINYLSRIHREEDFDFMLKGITRLLSNPIHs- 318  Caenor...
Q0E9B5               268 PLVEACLQLLIVTLDHDMVVQQQLtqpgqa-------sydegNCGDNLFINYLSRVHRDEDFHFVLKGITRLLNNPLV-- 338  fruit fly
EDS35074             273 PLVEVCLQILIVTLDHDITSNTSSnsptggaqsaqsyshddtTIADNLFINYLSRIHRDDDFQFILRGITRLLNNPLV-- 350  southe...
EEN51597             270 PTVEVALQLLIVVLDHD-NGQSAIsvdgtttg--tamdqgaeGEPQNLFVNYLSRIHREEDFHFILKGITNLLNNPLI-- 344  Florid...
EDO48052             243 PMVEVAAQLLVVLLDHDGGDGQNPinddla------ndmmepPPMDNLFCNYLSRIHREEDFHFILHGLANLLNNPLI-- 314  starle...
WGS:AATM:SJAG_00567  248 TLVELCFTVFLTLITDPVIGSSSRflefa---------rtrnIALNNFFSKSISQLHRKSDFQFILDGFSRLLYSPIH-- 316  Schizo...
Q9P7M6               261 SLIEYCFSVLLILMSEENNNGTPCynnyr---------ssknTLPKNYFSILLSKLQPYSDFQIILDGMSRLLYPPMQ-- 329  Schizo...
Q5ASC1               296 IL--------------------------------------------------------------------------MQa- 300  Asperg...
Q6BSE0               376 kesenlkfNLNTGRQNQVSIW--ATECIMLLWELFQCNKSFRTLVGE-RYLHELLVIMLYYVCTYHRNVNHKNSVRIFSY 452  Debary...
ABN67750             369 kdv-esskfNIIKSGNQPSLW--ATEATMLIWELIQCNKKFKTLIYE-QSLPELLVVLFYYIFAFHSNVQHKNLVRICAY 444  Scheff...
XP_002643863         319 -------sSSYLPNSTKKVNF--HQELLVLLWKCCEFNQKFMFYVLKtSDVLDILVPILYHISDARNDSARVGLIHMGVF 389  Caenor...
Q0E9B5               339 --------QNYLPNSTKRLHC--HQELLILFWKICDYNKKFLYFVLKsSDVLDILIPILYHLNYSRADQSRVGLMHIGVF 408  fruit fly
EDS35074             351 --------QSYLPNSTKRLHC--HQELLVFFWKICDYNKs--------SDVLDILVPILYHLNDSRADQSRVGLMHIGVF 412  southe...
EEN51597             345 --------QTYLPNSCKKINF--HQEILVLFWKLCEFNKKFLFYVLKsSDVLDVIAPILYHLNDSRQDQSRVGLMHIGVF 414  Florid...
EDO48052             315 --------QTYLPNSCKKISF--HQELLILFWKMCDQNKKFLFYVLKsSDVLDILVPILYHLNDARSDQSRLGLMHIGVF 384  starle...
WGS:AATM:SJAG_00567  317 ---------FEKPNVVGVVMYdyYPLTLNLCKQMLHYNTRFFHYLVDtGRALDLFVFILYLSFEYLSEASTFDHLKICLI 387  Schizo...
Q9P7M6               330 ---------STIPKRSSLIMFdyYPLVLIFCKLFIHYNERFFHYLIDtDRAIDLFIFLLYLSFEYLGDPSTYNHLKLCVI 400  Schizo...
Q5ASC1               301 -------tTAYLPGSQKSVKW--APEMLVLFWEALQCNKRFRSFIIDsNRSHDFIILCIFYSITYKSDPAKQGVVRMCIF 371  Asperg...
Q6BSE0               453 FILYLSSDCLIMDKLFEPMDLtfYESLPTGYKISPGPVTYRDFIVTqicklli-----tlssgsnNTNNAKPSLLLTTLV 527  Debary...
ABN67750             445 LMLYCSSDKN-LDSIFEPMDHnlYESLPTNYKTNPAPTTTRDFLVTqicnlliymqtpqstytygATLTPSP-LMVTTLV 522  Scheff...
XP_002643863         390 IILLLSGERNFGVRLNKPYTA----KAN--INIQTFTGTHADLLILvfh-------------kliTTGNYRLQSLFDCFL 450  Caenor...
Q0E9B5               409 ILLLLSGERNFGVRLNKAYSA----TVP--MDIPVFTGTHADLLITvfh-------------kiiATGHQRLQPLFDCLL 469  fruit fly
EDS35074             413 ILLLLSGERNFGVRLNKPYTA----TVP--MDIPVFTGTHADLLITvfh-------------kiiATGHQRLQPLFDCLL 473  southe...
EEN51597             415 ILLLLSGERNFGVRLNKPYTV----RVP--MDIPVFTGTHADFLIIvfh-------------kiiTTGHQRLQPLFDCLL 475  Florid...
EDO48052             385 ILLLLSGERNFGVRLNKPYAV----RVP--MDIPVFTGTHADFLVVvfh-------------kiiTTGHQRLQPLFDCLL 445  starle...
WGS:AATM:SJAG_00567  388 ILRRLTTSKQFCEKLNIPFEQ--LSSLPTNRRVPFSKGSYADFSVTamt-------------siiTACKDYQSEAVLLLT 452  Schizo...
Q9P7M6               401 LLKRLTAEKYFCKRLNKPFQQ--QTALPISMPVPFEGGTYADFTIIais-------------llvQYTKDYHSEIAQMLC 465  Schizo...
Q5ASC1               372 ILQTMSVEPTFGKSLNKKFEA--QDTLPQSIRIPGFKGSYADFLLI---------------------------------- 415  Asperg...
Q6BSE0               528 EILYNLIPVvsskdievkddpekklgnsnpRGGLSYGACSSITQLILKFSTRPFLLDASFNADLLALIFRSVCTAIIKYP 607  Debary...
ABN67750             523 EILYNLIPPvatksleatndpakkltnsnpNGGLSYSTCSVINLLIGKYSSRTFLQEKSINSDLLALLIRAVCTAALKYP 602  Scheff...
XP_002643863         451 TIMVNVSPY---------------------MKSLSMVAANKLVHLVEAFSTPWFLFSSPTNPQLVFSLLEVFNNVIQYQF 509  Caenor...
Q0E9B5               470 TILVNVSPY---------------------LKTLSMVASVKMLHLLEAFSTPWFLLSAPSNHHLVFFLLEIFNNIIQYQF 528  fruit fly
EDS35074             474 TILVNVSPY---------------------LKTLSMVASIKLLHLLEAFSTPWFLYSAPSNHHLVFFLLEIFNNIIQYQF 532  southe...
EEN51597             476 TIIVNVSPY---------------------LKSLSMVASTKLLHLLEAFSTPWFLFSNPSNHHLVFFLLEVFNNIIQYQF 534  Florid...
EDO48052             446 TIIVNVSPY---------------------LKSLSMVAANKLLHLLEAFSTPWFLFANPTNHHLVFFLLEIFNNIIQYQF 504  starle...
WGS:AATM:SJAG_00567  453 ETLSYLVKY---------------------VDNITIASSRRLVKLFVNVSDLGFLLANPTNFKSTKNVYKIFGNLLRRRF 511  Schizo...
Q9P7M6               466 CSLCYLCLY---------------------AQNLNSHSSQSLFELFQSASYPGFLISNDVNHKILKYVIGAINNAIQYAQ 524  Schizo...
Q5ASC1               416 --------------------------------------------LFTSMSAPSFLLANESNHALLASVLESINAILEHKF 451  Asperg...
Q6BSE0               608 KPSRMLLFSMLKNEKVYDQVWSTIYSFSTEYFSGDTL------------------------------------------- 644  Debary...
ABN67750             603 KSSRMLLFSILKNAKVYDQVWNTIYSFRTEYFNGNKL------------------------------------------- 639  Scheff...
XP_002643863         510 DGNSNLIYTIIRKRNVFYQLSNLSVDSASIAKTLSGRksk---------------------------------------- 549  Caenor...
Q0E9B5               529 DGNSNLVYTIIRKRHVFHAMANLPTDMAGIAKCLSGRktggkfnlprvpqrrtpavsqelpsahvpeeyneedededeee 608  fruit fly
EDS35074             533 DGNSNLVYTIIRKRQVFHALANLPTDAAGIARCMSNRkggklnnsshgsrssgreqlqnke-vlpstshaeddseeditv 611  southe...
EEN51597             535 DGNANLVYTIIRKRNVFHQLANLPTDRASIEKAVSRK------------------------------------------- 571  Florid...
EDO48052             505 DGNSQLVYAIIRKRNIFHQLANLPTDPATIQKPKRKEh------------------------------------------ 542  starle...
WGS:AATM:SJAG_00567  512 SQNPKFVYTVLRAHETLCSTIPANFSRAKEIVTQNQPdmsvylsssnk---------------------------tytkh 564  Schizo...
Q9P7M6               525 KYNAPLLYFFSMHKDYIEAVSALSFDAIMSVRNSSAEgdsaywtr--------------------------------ngk 572  Schizo...
Q5ASC1               452 -----MIYAILKYRRRFEAVREFTLESGQQEIERQNQrrk---------------------------------------- 486  Asperg...
Q6BSE0               645 -----VLNSIDDNEDENISPLQQIDSnRSDQVSISSSIESEANDSIFINNFTSPKSRHGSNVSGSIPPlt---------- 709  Debary...
ABN67750             640 -------NRIDDGEEENENILSVVNSnNSE----------RFKPESETTDSESPQTRKNSMFGIGTPPmt---------- 692  Scheff...
XP_002643863         550 --sanRDEMVDQLKSPTTANPPEFPAaGASSSTPPASSGPSTTAGLAATPALASMT------------------------ 603  Caenor...
Q0E9B5               609 iineePKAEEDLESETESHERSQAGElQSDVLTAQPAEPGTLKTSLLDTPGITQMTEREQAHPNDKPQvedstdivpyd- 687  fruit fly
EDS35074             612 rtgqiQIQDRHSDEEESDSRSEIIEEsMEGSHPALPAEPGTLKVTLLETPDIAQMTERESAHPSSADAlaaatpspvepn 691  southe...
EEN51597             572 -----RKGSEASQRPVPHSPAVTDPPsMEGSFPAQEAQPGTLKATLAEMPGIERLTEKMEASSLAEQAaedadtpg---- 642  Florid...
EDO48052             543 -----------------------IPNmREGEHSRSPEDPVS-----RATPGPSHTQKK---------------------- 572  starle...
WGS:AATM:SJAG_00567  565 iferaLLDEKLNAEKRQNGYSTRDRRhRRIEKLYRDVDHSSLESSVSVTHPEEKPFRQGKDSETQNEQff---------- 634  Schizo...
Q9P7M6               573 tfsskAFDSILLSRLRYVRSKSPTPYyPIESSEFGFTNLKDVTSKDEITDGFDKALRSNSLRTHRDSRpvqpllk----- 647  Schizo...
Q5ASC1               487 ---seNRDSIASPVLSASDEDPRLSS---GARSP-LGRIPEENNPFAIGGDDSEDEGDGRHTPPQDSAsvqtsrrqsmss 559  Asperg...
Q6BSE0               710 ------------------pEFDLNFFEDESQAIDSALRPKPPTGMsQKARDKLPKDAPLKRSWGGNDSLRIILTIIiphl 771  Debary...
ABN67750             693 -------------------iPEESQQSDAEEELEASLRPKLPTGMsERAREKLPKESSLKRSWGGNDSLRILLTIVipyl 753  Scheff...
XP_002643863         604 -----------------------------GNVGNWEEKPESQ-------EEEWIATQEWAEAWKSKLPLQTIMRLL---- 643  Caenor...
Q0E9B5               688 --------rsaastptderKSTSPTELSRLSVAHRASIRMVPGE-----SDRWTPTPEWIVSWRSKLPLQTIMRLL---- 750  fruit fly
EDS35074             692 aksaiggdgvksgsspkgsPSKEQPSPIKRAVAQRGSIRVTPTGThGSQAKVWQPSPEWVQSWRSKLPLQTIMRLL---- 767  southe...
EEN51597             643 -----------aagpspsdTETSVQPDLRGAVKRTASMSSRE-------GGEWRPTSEWVQSWKQKLPLQTIMRLL---- 700  Florid...
EDO48052             573 ------------------------------AIGRSASVSS---------TGAFIATPEWVQSWKQKLPLQTIMRML---- 609  starle...
WGS:AATM:SJAG_00567  635 -----------------trAAPLSQSNIDYNTDVNGESKLLDSIVpHAYDHTFTPTKQWYEEWRHQLDIEPFTRLV---- 693  Schizo...
Q9P7M6               648 ------------qrpqlhrALTESATLHGNDRSLEDTDEAKVEPIaHSVDYTFKPTVEWWNKWWPSLNFRTMLDIF---- 711  Schizo...
Q5ASC1               560 vid--esvplqlrgmsekaRGKMPAGQPSFSRQNSMTSQISMSAIfPSSSGGFTPTTAWLESWLPELPLHTILTII---- 633  Asperg...
Q6BSE0               772 KLVLKEI--WSSREGPSIDSfllvkyieSTDFDKLIQENKGqlnydflPTTPLEPLKFNWSHLSLGWYMSLLFGNVYNAG 849  Debary...
ABN67750             754 KVVLKEI--WSSKDGPTVDSyllvehieKADFDDLLERSKTqinydflPDKPLDKLKFNWSHLSLGWYISLLGGAVYNSV 831  Scheff...
XP_002643863         644 QVLVPQVekICIDKGLTDESei-----lKFLQHGTLVGLLP-------VPHPIVIRRYQTNVGTNHWFRIYMWGVIYLRN 711  Caenor...
Q0E9B5               751 QVLVPQVekICIDKGLTDESei-----lKFLQHGTLVGLLP-------VPHPILIRKYQANAGTTAWFRTYIWGVIYLRN 818  fruit fly
EDS35074             768 QVLVPQVekICIDKGLTDESei-----lKFLQHGTLVGLLP-------VPHPILIRKYQANSGTTAWFRTYMWGVIYLRN 835  southe...
EEN51597             701 QVLVPQVekICIDKGLTDESei-----lKFLQHGTLVGLLP-------VPHPILIRKYQANSGTTMWFRTYMWGIIYLRN 768  Florid...
EDO48052             610 QVLVPQVekICIDKGLTDESei-----iKFLQHGTLVGLLP-------VPHPILIRKYQANSGTQMWFRTYMWGIIYLRN 677  starle...
WGS:AATM:SJAG_00567  694 ELVFPDVvrMRSE---------------GFSSQQIFQALSNcelyddqPAEPPSFETSTWRDELAHFSKLLTWSTAYDLD 758  Schizo...
Q9P7M6               712 TDLSLKIsdMKKA---------------GHPASEIMAMIKTqkypatnQPYIPKYRTKEWRQQLANFARLFAWQVSCDLD 776  Schizo...
Q5ASC1               634 SAIMPSIpeSAFQSS-NGESrtlisnlpSFAEDPLIQSIIS-------DPTPPRVHSFEWSALSMGWYESLLWGFIFSAE 705  Asperg...
Q6BSE0               850 DNVKAftgyknkimknfsstlvsfskltsgwaglnmqltgtgtmsndsdvvssyvesalTNINPWAYTSIKLFKI 924  Debaryomyce...
ABN67750             832 DSVKTytgnnnkimknittsiasvskltsswt-gfmkhsttaysandsaevaewvksslTAVNQWNHTDVKLFKI 905  Scheffersom...
XP_002643863         712 T-----------------------------------------------------------QPPIWYDTDVKLFEI 727  Caenorhabdi...
Q0E9B5               819 V-----------------------------------------------------------EPAIWYDTEVKLFEI 834  fruit fly
EDS35074             836 V-----------------------------------------------------------DPAIWYDTEVKLFEI 851  southern ho...
EEN51597             769 V-----------------------------------------------------------DPPIWYDTDVKLFEI 784  Florida lan...
EDO48052             678 I-----------------------------------------------------------DPPIWYDTDVKLFEI 693  starlet sea...
WGS:AATM:SJAG_00567  759 Rrn-------------------------------------------------------hNGMGIWTNTEVRLLKF 778  Schizosacch...
Q9P7M6               777 Shk-------------------------------------------------------rEGPGIFEGTDVKIFDS 796  Schizosacch...
Q5ASC1               706 MVVGSasg------------------------------------------------atpGTVGVWNGTSIKLFKV 732  Aspergillus...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap